SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004312 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004312
Domain Number 1 Region: 774-954
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.1e-43
Family Ypt/Rab-GAP domain of gyp1p 0.004
Further Details:      
 
Domain Number 2 Region: 929-1048
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 157-192,231-377
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-31
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-19
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004312   Gene: ENSOGAG00000004823   Transcript: ENSOGAT00000004827
Sequence length 1166
Comment pep:known_by_projection scaffold:OtoGar3:GL873733.1:1652870:1867627:1 gene:ENSOGAG00000004823 transcript:ENSOGAT00000004827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPFPNEVSVDFSLQLVGFLPVHALTTMPMLPWVVAEVRRRSGQSSRKEPL
PKQVQLCVSPSGLRCEPEPGKSQQWDPLNCSSIFECKPQHVHKLIHNSHDPSYFACLIKE
DAVRRQNICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSCSRKADLDLPSRTGSSGTGMVGATRRPMRKSSSQPG
LRSLAFRKDFPDGSLRSSSFFSSFEESDIENHLISGHNIVQPTDMEENRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCANEALV
DEIMMTLKQAFTVAAVQQTARAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTT
LTNQEQATIFEEIQKLRPRNEQRENELIISFLRCLYEDKQKEHVHIGDTKQTSQIPAENI
GSELPPSATRFRLDMLKNKAKRSLTESLESILSRGNKAKGLPEPSASVDLESSVSSTLSN
TSKEPSVYEKEAVPLSGSSFKLPGSSDDLSSDAESHLLEEPAPLSPQQAFRRRANTLSHL
PAECQEPLEAARASPVVPQRKLVRYHSVSTETPHERKDFESKAEHLGDCGGTPVKARRHS
WRQQIFLRVATPQKACDSPGRYEDFSELGELPPRSPLEPVCEDGPFGPVPEEKKRTSREL
RELWQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTAVWEKMLST
PGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKDVLYKELLKQ
LTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGIL
LLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEI
GPSLYAAPWFLTVFASQFPLGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQHENLE
TIVDFIKNTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQRM
DKLEKTNSSLRKQNLDLLEQLQVANGKIQSLEATIEKLLSSESKLKQAALALELERAALL
QTVGELRRQAAELSSQGTDDSAPPST
Download sequence
Identical sequences H0WQR2
ENSOGAP00000004312 ENSOGAP00000004312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]