SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004979 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004979
Domain Number 1 Region: 220-482
Classification Level Classification E-value
Superfamily Caspase-like 5.98e-78
Family Caspase catalytic domain 0.000000084
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily DEATH domain 1.74e-22
Family Caspase recruitment domain, CARD 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004979   Gene: ENSOGAG00000005570   Transcript: ENSOGAT00000005571
Sequence length 483
Comment pep:novel scaffold:OtoGar3:GL873719.1:1067513:1119041:-1 gene:ENSOGAG00000005570 transcript:ENSOGAT00000005571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTDKVLREKRRQFIQSVGTGTINGLLDELLEKRVLNQEEMEKVRDENATVMDKARALIDG
VIRKGPQASQVFIINICNNDCHLAQTLQLSGPQSVNDLWSKPDSQTAFSSFSEDNCTNKN
PLKILEYLSKDIMHNMSKKIDEKSKEAEKKNNCDTKTEDKTWVLVNTVENHEVEEVVIQP
FLTTDQMASSLEAAPEMKAGPPEAAEPTDTLKLCPHEDFLRLSRERAAEIYPIKGKTAGR
SRLALIICNTEFDHLAPRGGADLDVKGMKGLLESLGYSVDVKEKLTAQGMESELRAFAAR
PEHVSSDSTFLVLMSHGVLDGVCGTAHGPEARDVLPYDTIFQIFNNRNCLGLRDKPKVII
VQACRGQNRGEVWVRDSPEALVDSTSQSPDTLEDDAVRVTHVEKDFIAFCSSTPHNVSWR
HITKGSLFITQLITCFQKYSWRYHLEEIFRKVQQSFESPSTRAQMPTVERLSMTRYFYLF
PGN
Download sequence
Identical sequences H0WSC0
ENSOGAP00000004979 ENSOGAP00000004979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]