SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005051 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005051
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 6.33e-41
Family Globins 0.000000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005051   Gene: ENSOGAG00000005651   Transcript: ENSOGAT00000005654
Sequence length 154
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:11878841:11888592:1 gene:ENSOGAG00000005651 transcript:ENSOGAT00000005654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLKIWGKVEADLAGHGQDVLIRLFTAHPETLEKFDKFKNLKTPDEMKASE
DLKKHGVTVLTALGGILKKKGQHEAEIKPLAQSHATKHKIPVKYLEFISEAIIHVLQNKH
SGDFGTDVQGAMSKALELFRNDIAAKYKELGFQG
Download sequence
Identical sequences H0WSI7
XP_003783307.1.62490 ENSOGAP00000005051 ENSOGAP00000005051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]