SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005252 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005252
Domain Number 1 Region: 617-872
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-42
Family YWTD domain 0.0000199
Further Details:      
 
Domain Number 2 Region: 1493-1771
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-31
Family YWTD domain 0.0000986
Further Details:      
 
Domain Number 3 Region: 518-609,865-926
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-24
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 1397-1517,1763-1819
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000691
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 1233-1269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 6 Region: 954-994
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 361-397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 1154-1189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 9 Region: 1077-1113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 10 Region: 1275-1319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 11 Region: 491-531
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000435
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 12 Region: 147-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 13 Region: 1359-1398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 14 Region: 404-438
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 1194-1231
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 16 Region: 917-952
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 17 Region: 1111-1151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 18 Region: 282-318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 188-227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 20 Region: 1037-1073
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 321-363
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 22 Region: 996-1033
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 23 Region: 440-481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 24 Region: 241-277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000864
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 112-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000942
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 26 Region: 1990-2030
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000212
Family EGF-type module 0.035
Further Details:      
 
Domain Number 27 Region: 1321-1353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 28 Region: 1890-1925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.031
Further Details:      
 
Domain Number 29 Region: 1853-1891
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000367
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000005252
Domain Number - Region: 1817-1852
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000112
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 5-56
Classification Level Classification E-value
Superfamily YWTD domain 0.000262
Family YWTD domain 0.0046
Further Details:      
 
Domain Number - Region: 1927-1959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0143
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 66-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0323
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005252   Gene: ENSOGAG00000005855   Transcript: ENSOGAT00000005871
Sequence length 2201
Comment pep:known_by_projection scaffold:OtoGar3:GL873599.1:8632432:8943740:-1 gene:ENSOGAG00000005855 transcript:ENSOGAT00000005871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIVKSGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTEILRSDIPHQPMGIIAVAN
DTNSCELSPCALLNGGCHDLCLLTPNGKVNCSCRGDRVLLDDNRCVTKNSSCNIYSEFEC
GNGECIDYQLTCDGIPHCKDKSDEKLLYCENRSCRRGFKPCSNRRCVPHSKLCDGENDCG
DNSDELDCKVSTCATVEFRCADGTCIPRSARCNQNIDCADASDEKNCNNTDCTHFYKLGV
KTAGFIRCNSTSLCVLPTWICDGSNDCGDYSDELKCPVQNKHKCEENYFGCPSGRCILNT
WICDGQKDCEDGLDEFHCDSSCSWNQFACSAQKCISRHWICDGEDDCGDGLDESDSICGT
ITCAADMFSCQGSHACVPRHWLCDGERDCPNGSDELSTAGCAPNNTCDENAFMCRNKVCI
PKQFVCDHDDDCGDGSDESLQCGYRPCGAEEFSCADGRCVLNTQWQCDGDFDCPDHSDEA
PLNPKCKTAEQSCNSSFFMCKNGRCISSGHLCDNKDDCGDGSDESNCHINECLSKKVSGC
SQDCQDLPVGYKCKCWPGFQLKDDGKTCVDIDECSSGFPCSQQCINTYGTYKCICTEGYE
VQPDNPNGCKSLSDEEPFLILADHHELRKISTDGSNYTLLKQGLNNVIAIDFDYSEEFIY
WIDSSRPNGSRINRMCLNGSDVKVVHNTAVPNALAVDWIGKNLYWSDTEKRMIEVSKLNG
LYPTILVSKRLKFPRDLSLDPQAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKISRPMA
LTIDYVNHRLYWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLS
RAHKTSGTDRLSLINSWHAITDIQVYHSYRQPDVSNHFCMINNGGCSHLCLLAPGKTHTC
ACPTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFKCQ
PGRFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNLRCNG
QDDCGDEEDERDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGP
HEFQCKNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVSSRFWCDGDF
DCADGSDERNCETSCSKDQFQCSNGQCISAKWKCDGHEDCKYGEDEKNCEPASPSCSSSE
YICASGGCVSASLKCNGEYDCADGSDEMDCVTECKEDQFRCKNKAHCIPIRWLCDGIHDC
VDGSDEEKCDRGGNICRADEFLCNNSLCKLYFWVCDGEDDCGDNSDEAPDLCVKFLCPPT
RPHRCRNNRTCLQSEQMCNGIDDCGDNSDEDHCSGKLTYKARPCKKDEFACSNKNCVPMD
LQCDQLDDCGDGSDEQGCRLSSTEFTCEDNVNPCGDDAYCNQIKTSVFCRCKPGFQRNMK
NRQCEDLNECLVFGTCSHQCINVEGSYKCVCDQNFQERNNTCIAKGSEDQVLYIANDTDI
LGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDIIIWSTQFNPGGIFYKRIHGREKRQ
VNSGLICPEFKRPRDIAVDWIAGNIYWTDHSRMHWFSYYTTHWTSLRYSINAGQLNGPNC
TRLLTNMAGEPYAIAVNPKRGMMYWTVIGDHSHIEEAAMDGTLRRILVQKNLQRPTGLAV
DYFGERIYWADFELSVIGSVLRDGSDLVVSVSSKQGLLHPHRIDIFEDYIYGAGPKNGVF
RVQKFGHGSVEYLSLDVDKTKGVLISHRYKQLDLPNPCLDLACEFLCLLNPSGATCVCPE
GKYLSNGTCNDDSLLDDSCKLSCENGGKCILNEKGDLRCHCWPSYSGERCEVNHCSNYCQ
NGGTCIPSVLGRPTCTCALGFTGPNCGKTVCEDFCQNGGTCIVTAGNQPHCHCQAEYTGD
RCQYYVCHHYCVNSESCTIGDDGSVECVCPTRYEGPKCEIDKCIRCHGGHCIINKDTEDI
LCNCTNGKIASSCQLCDGYCYNGGTCQLDPEINVPVCLCSANWSGTQCERPAPKSSKSDH
ISTRSIAIIVPLILLVTLITTLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNPSYNMY
EVDHDHNDGGLLDPGFMIEPTKTRYIGGGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYS
NPVYAKLYMDGQHCRNSLGSVDERKELLPKKLEIGIRETVA
Download sequence
Identical sequences H0WT08
ENSOGAP00000005252 ENSOGAP00000005252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]