SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005335 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005335
Domain Number 1 Region: 546-820
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.57e-86
Family Eukaryotic proteases 0.0000832
Further Details:      
 
Domain Number 2 Region: 324-438
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000116
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 3 Region: 72-160
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000209
Family SEA domain 0.0074
Further Details:      
 
Domain Number 4 Region: 483-514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 519-558
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 232-316
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000419
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Domain Number 7 Region: 448-481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005335   Gene: ENSOGAG00000005964   Transcript: ENSOGAT00000005969
Sequence length 822
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:10700521:10730573:1 gene:ENSOGAG00000005964 transcript:ENSOGAT00000005969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMAEAPQVAGGQSDGGDGEEAEPERVFKAPEDTKRKAQNYLRLAPLWLALIVLVSVGVL
LWYFLGYKAEVTVSQVYAGSLRVLNRHFSQDFAHRESSAFRSETAKAQKMLKELLASTRL
GTYYNSSSVYALGEGPLTCFFWFILQIPEHRRPMLGPEVVQALLVEELLSTANSSAPARY
RAEYEVDPEGLVILEASVKDIVALNSTLGCYRYSYVSLGQVLRLKGPDQLASSCLWHLQG
PKDLMLKLRLEWTLAECRDRLAMFDAAGPLERRLITSVYGCSRQEPVVEVLASGAIMAVV
WKKGLHSYYDPFVLSVQPVAFRGCEVNLTLEGRLEPQGVLSTPYFPSYYSPSTHCSWHLT
VPSLDYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRLCGLRTLQPYAERIPVVATAGIT
INFTSQISLTGPGVQVHYGLYNQSDPCPGEFLCSVNGLCVPACDGIKDCPNGLDERNCVC
RATFQCREDSTCISLSRVCDGRSDCFNGSDEQQCQEGVPCGTFTFQCEDQSCVKKPNPQC
DGQPDCRDGSDEQQCDCGLQGPSTRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADRW
VITAAHCFQEDSMASPTLWTVFLGKVWQSSRWPGEVSFKVSRLLLHPYHEEDSHDYDVAL
LQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGGEQGDPCHIHQGWRVQTQ
PRAWGPTSNALQKVDVQLIPQDLCSEAYRYQVTPRMLCAGYLKGKKDACQGDSGGPLVCK
APSGRWFLAGLVSWGLGCGRPNYFGVYTRITGVISWIQQALT
Download sequence
Identical sequences H0WT78
ENSOGAP00000005335 ENSOGAP00000005335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]