SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005351 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005351
Domain Number 1 Region: 36-276
Classification Level Classification E-value
Superfamily Caspase-like 1.27e-93
Family Caspase catalytic domain 0.000000000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005351   Gene: ENSOGAG00000005985   Transcript: ENSOGAT00000005986
Sequence length 277
Comment pep:known_by_projection scaffold:OtoGar3:GL873580.1:2799035:2806204:1 gene:ENSOGAG00000005985 transcript:ENSOGAT00000005986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENTENSVDSKSIKNLETKIIHGSKSMDSGISLDTRYKMDYPEMGLCIIINNKNFHESTG
MPPRSGTDVDAANLRETFMNLKYEVRNKNDLTCEEIVAFMRNVSKEDHSKRSSFVCVILS
HGEEGIIFGTNGPVDLKKITSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTED
DMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKLYAHKLEFMHILTRVN
RKVATEFESFSFDSTFHAKKQIPCIVSMLTKDLYFYH
Download sequence
Identical sequences H0WT92
ENSOGAP00000005351 ENSOGAP00000005351 XP_003792832.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]