SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005359 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005359
Domain Number 1 Region: 731-981
Classification Level Classification E-value
Superfamily RNI-like 4.81e-48
Family 28-residue LRR 0.0001
Further Details:      
 
Domain Number 2 Region: 1383-1469
Classification Level Classification E-value
Superfamily DEATH domain 4.62e-17
Family Caspase recruitment domain, CARD 0.027
Further Details:      
 
Domain Number 3 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 6e-17
Family Pyrin domain, PYD 0.0000985
Further Details:      
 
Domain Number 4 Region: 332-507
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000418
Family ABC transporter ATPase domain-like 0.09
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000005359
Domain Number - Region: 618-640
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 0.0458
Family T-antigen specific domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005359   Gene: ENSOGAG00000005990   Transcript: ENSOGAT00000005996
Sequence length 1482
Comment pep:novel scaffold:OtoGar3:GL873664.1:30763:70456:-1 gene:ENSOGAG00000005990 transcript:ENSOGAT00000005996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGAHWQLGYYLELLKKEELKEFQLQLSSEASFQGPSSAAAVPPEKMSGMEVASRLVAQ
YGQQQAWDLALQTWRQMGLNSFCARAQAELALLSGDDLPSLCSPSIPNLESPNPPSPAVM
QESFDSRVLEKIGYLGYTQHSERRTSDQLTDTSRRHWKENPYLPFYQALPSSPDQQSPSQ
ESPNTPTSTAVLRGGKSPPQPNPEPRKQESPGAEWPLAETSEKYFTRIREKERKESRKEG
RGSPEMPYGTGPPSISNILGKRHQNQKREHLCFTQSWKNEDLHKKFTQLLLLQRPHPRGL
ESLVIKKTQNPVVENLGHLIEIGDLFASGLGTQEEPRIVILHGAAGIGKSTLARQVQRGW
EEGRLYQDRFQHVFYFSCAELAQSKVMSLAELITQAQEAPPAPLQQVLSRPEQLLFILDG
VDEPRWVLWQESTEFCQHWSQPQQVAMLLGSLLGKTILPEASFLITTRTVALQKLIPSLK
QPRWVEVLGFSESSRKEYFYNYFTDENQALRALSLVESNPAVWTMCLVPWLSWLVCTCLK
QQMERGEDLTLTTPTATGFCLRYLSQALPAQPLGHHLRGICSLAAEGIWRKRSLFRLHDF
GRHGLDGPVISTFVTMGVLRKYPNSWGYCFIHRCFQEFFAAVSCALGDEKERGEHPNSIR
GVGGLLQAYKTHDLSRAPTRRFLFGLLSEQAGREMESIFTCQQAPELKQELVKWAKRESW
VLRSPQQPGFLELFHCLYETQDEEFLTQVIGHFLASSVCVQTGMELLVFTFCIKFCHYVK
RLQLHEGGQHRPRWRPARVVLFMQVPVTDACWQLLFSILEVTGSLKELDLSGNSLSHSAV
QSLSETLRCPHCHLETLRLASCGLTAEGCKDLVLGLSTSETLTELELSFNMLMDAGAEHL
CWGLRQQNCRLRRLQLVGCGLTSSCCRDLASVLSTNPSLKKLDLQQNDLGDHGVRLLCEG
LRHPVCSLTLLWLDQAPLGEELKEELRTLEKEKPALLISSRWEKPSVMNPNVGGEKTSNM
FSLKRQRRESGPQRSSIGGKGESRADHCPAVPEGSSSQAVQMEPLSLSPPAPLRTFHMEP
PGTEDEFLDPTGPVAAEVVDIETRSLYRVHFPKSGTYDWHNTGLHFVVRRAVTIEIEFCS
WKQFLDGNMSQHSWMVAGPLLDIKAEPGSVAAVYLPHFVDLQGGQVDVSLFQVAHFKEEG
MLLEKPAQVEPHYIILENPSFSPMGVLLRIFHAALPFLPITSMVLLYHQPQHKEDKFHLY
LIPNDCCIRKAIDDEEKKFQFVRIHKPNLLTSLYMGSRYTMSGSGKLEIIPKELELCYRS
PGEAQMFSEFYVAHVGSGFRLKMRDKKHRTVVWKALVKPGDLRPAASLGPPAAVALLSFP
DTPALLHFVDRHREPLITRVTSVDSVLDKLHGQVLNEEQYEQVRAEATRPDQMRKLFSFS
KSWDQTCKDRLYQALKETHPHLIMDLFEGQMWLQRGLLPPRS
Download sequence
Identical sequences H0WTA0
ENSOGAP00000005359 ENSOGAP00000005359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]