SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005993 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005993
Domain Number 1 Region: 769-1016
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.03e-76
Family Eukaryotic proteases 0.0000701
Further Details:      
 
Domain Number 2 Region: 432-557
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.02e-33
Family Frizzled cysteine-rich domain 0.00016
Further Details:      
 
Domain Number 3 Region: 117-229
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.07e-30
Family Frizzled cysteine-rich domain 0.00082
Further Details:      
 
Domain Number 4 Region: 559-598
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 323-358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 248-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 283-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000105
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 636-676
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 9 Region: 358-393
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 602-634
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 11 Region: 670-769
Classification Level Classification E-value
Superfamily SRCR-like 0.00000824
Family Scavenger receptor cysteine-rich (SRCR) domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005993   Gene: ENSOGAG00000006697   Transcript: ENSOGAT00000006701
Sequence length 1024
Comment pep:known_by_projection scaffold:OtoGar3:GL873602.1:4130013:4349693:-1 gene:ENSOGAG00000006697 transcript:ENSOGAT00000006701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGADDTNVGDGCSQKLVMTNLLRFLLLVLIPCICALVVLLVILLSFVGTLKKTYFKSNG
SEPLVTDGKGQTSDVILPNMINDKSPMASTARPSPHIPDWMTGASLPGDQSHRNISACRN
ITHSQCLVLPYNTTLEPLLPIVKYMDMEKFLKFFTYLHRLGCYQHIMLFGCSLAFPECIN
DGDDSRGLLPCRSFCESAKEGCEAVLGIVNYTWPDFLKCSQFRNQTENSNISRVCFSPQQ
ENGKQMLCGGGESFLCASGICIPGKLQCNGYNDCDDWSDEAHCNCSKNLFHCHTGKCLNY
SLVCDGYDDCGDLSDEQNCDCNPTQQHRCGDGRCIALEWVCDGDHDCVDKSDEANCSCHS
QGLVECRSGQCIPSTFQCDGDQDCKDGSDEENCSDSQTPCHEGDQRCLYNSCLDSCGGSS
LCDLNNSLSNCSRCEPITLELCMNLPYNYTSYPNHLGHRTQKEASISWESSLFPALVQTN
CYKYLMFFACTILVPKCDVNTGQRIPPCSSPRALCEHSKERCESVLGIVGLQWPEDTDCS
QFPEETADNQTCLMPNEYVEECSPSHFKCRSGRCVLASRRCDGQADCDDDSDEENCGCKE
RDLWECPSSKQCLKHSVVCDGFPDCPDSMDEKNCSFCQDDELECVNHECVSRDLWCDGQV
DCSDSSDEWDCVTLSKNANSSSFLTVHRGATEYHVCADGWQETLSQLACKQMGLGEPSET
KLLQLQENEQRWLTLHPLWQSLPGTTLHRLLVNGQSCESGSKISLLCNKQDCGRRPAARM
NKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKRWVLTVAHCFEGRESAAVWKVVL
GIGNLDHPSAFTQTRLVKTIVLHPRYSRAVVDYDISIVELDGDINDTSYVRPVCLPSPEQ
WLEADTYCYITGWGHMGNKMPFKLQEGEVRIISLEQCQSYFDMKTITTRMICAGFESGTV
DSCMGDSGGPLVCERPAGQWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIQRQIYIQT
FLLD
Download sequence
Identical sequences H0WUQ7
ENSOGAP00000005993 ENSOGAP00000005993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]