SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006090 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006090
Domain Number 1 Region: 83-211
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.58e-25
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Domain Number 2 Region: 20-89
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-19
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006090   Gene: ENSOGAG00000006808   Transcript: ENSOGAT00000006810
Sequence length 343
Comment pep:known_by_projection scaffold:OtoGar3:GL873541.1:17628118:17664053:1 gene:ENSOGAG00000006808 transcript:ENSOGAT00000006810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGGYEELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYAL
LGIPLTLVMFQSLGERINTFVRYLLHRVKKGLGMRRADVSMANMVLIGFFSCISTLCIGA
AAFSYYEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVI
GAFLNLVVLRFMTMNAEDEKRDAEHRALLTRNGQVVGCSGGGGGGGGSAHTTDTASSTAA
AGGGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEHSHSSPGMGG
RYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRSLMKRRSSV
Download sequence
Identical sequences H0WUY4
ENSOGAP00000006090 ENSOGAP00000006090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]