SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006417 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006417
Domain Number 1 Region: 4-32,84-152
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-22
Family Voltage-gated potassium channels 0.0058
Further Details:      
 
Domain Number 2 Region: 156-268
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-19
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006417   Gene: ENSOGAG00000007163   Transcript: ENSOGAT00000007167
Sequence length 393
Comment pep:known_by_projection scaffold:OtoGar3:GL873659.1:1231066:1238122:1 gene:ENSOGAG00000007163 transcript:ENSOGAT00000007167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSTTLLALLALVLLYLVSGALVFQALEQPQEQQAQRELGEARERFLKAHPCVSNQELGL
FIQEVADALGGGANPETNSTSNSSHSAWDLGSAFLFSGTIITTIGYGNVALRTDAGRLFC
IFYALVGIPLFGILLAGVGDRLGSSLRRGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGC
LLFVLTPTFVFCYMENWSKLEAIYFVIVTLTTVGFGDYVAGADPKQDFPAYQPLVWFWIL
LGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPTAPPPEKE
RPLLPPPPCPEQPVGRPRPPTSPEKPEPPSSPTASALDYPSENLAFIDESSDTQSERGCA
LPHVPRGRRRPNPSRKPARPRGPGRPREKGVPV
Download sequence
Identical sequences H0WVR7
ENSOGAP00000006417 ENSOGAP00000006417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]