SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007084 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007084
Domain Number 1 Region: 3170-3434
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-51
Family YWTD domain 0.00000303
Further Details:      
 
Domain Number 2 Region: 366-626
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-42
Family YWTD domain 0.00000894
Further Details:      
 
Domain Number 3 Region: 1408-1669
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-41
Family YWTD domain 0.0000104
Further Details:      
 
Domain Number 4 Region: 2359-2595
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-41
Family YWTD domain 0.0000171
Further Details:      
 
Domain Number 5 Region: 679-932
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-40
Family YWTD domain 0.0000165
Further Details:      
 
Domain Number 6 Region: 1716-1982
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-39
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 7 Region: 2039-2305
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-35
Family YWTD domain 0.0000453
Further Details:      
 
Domain Number 8 Region: 4026-4297
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-35
Family YWTD domain 0.0000518
Further Details:      
 
Domain Number 9 Region: 2704-2747
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000288
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 3115-3163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000135
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 11 Region: 1117-1154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 2828-2867
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 13 Region: 3768-3805
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 14 Region: 1240-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000186
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 15 Region: 1076-1114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 1672-1711,1991-2028,2304-2354
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000204
Family Growth factor receptor domain 0.024
Further Details:      
 
Domain Number 17 Region: 3598-3637
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 18 Region: 2669-2707
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 19 Region: 2958-2999
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 3000-3040
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 74-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 23 Region: 3727-3765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 24 Region: 1033-1073
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 1196-1234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 26 Region: 3811-3845
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 3040-3080
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 28 Region: 192-228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 29 Region: 2872-2910
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 30 Region: 3481-3516
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 31 Region: 3518-3559
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 32 Region: 154-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 3689-3726
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 34 Region: 2784-2830
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 35 Region: 1155-1193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 36 Region: 3559-3599
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 37 Region: 992-1030
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 38 Region: 38-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000106
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 39 Region: 3082-3128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000148
Family EGF-type module 0.013
Further Details:      
 
Domain Number 40 Region: 3896-3933
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 41 Region: 235-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 42 Region: 1323-1369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000352
Family EGF-type module 0.012
Further Details:      
 
Domain Number 43 Region: 2914-2958
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 44 Region: 3853-3891
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 45 Region: 1360-1399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000328
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 46 Region: 119-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 47 Region: 3647-3685
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000055
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 48 Region: 3978-4010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000652
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 49 Region: 629-674
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family EGF-type module 0.017
Further Details:      
 
Domain Number 50 Region: 1280-1316
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 51 Region: 2754-2789
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000511
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 52 Region: 4351-4385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000969
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000007084
Domain Number - Region: 319-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 3940-3979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000329
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 286-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00318
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 948-987
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00475
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 4306-4330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0435
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 3438-3469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0437
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007084   Gene: ENSOGAG00000007904   Transcript: ENSOGAT00000007916
Sequence length 4631
Comment pep:known_by_projection scaffold:OtoGar3:GL873609.1:7911584:8089604:-1 gene:ENSOGAG00000007904 transcript:ENSOGAT00000007916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDSDHFRCNNGQCIPASWRCDTTKDCSDDSDEHGCPPPSCRTGYVPCLSEGTCIPNTWVC
DHDQDCSDGSDEQHCPETTCSSNQMRCSNGECIPSEYRCDHVTDCSDESDEKHCQYPRCE
QLTCANGACYNTSQRCDSLVDCRDHSDEMNCTNVCLRDEFACNNGQCIPKTYVCDHEEDC
EDSSDEHDCNYQTCNGSQFTCSSGRCIHQNQVCDGQADCKDGEDENGCESNSSSNCAPRQ
WVCPGSGQCIPIDKVCDGFSDCPGGKDENSTTTESFCDTSICSALNCEHQCHKTPRGGAC
FCPPGFVINHMDMRTCDEFDDCQIWGICDQKCENRHGHIRCFCEEGYILENEQNCKANDS
SGQPSIIFSNGQDLLIGDVHGTSFRNLVESPRGMAVGVDFHYRLGKVFWTDYVRNKVYSV
NINGLNIQEVLNVSVDSPENLAVDWVNNKLYVVETRINRIDVANLDGSYRVTLITENLGR
PRGIALDPTVGYLFFSDWESLSGEPKVERAFMDGSNRKDLVKTKLGFPGGITLDLIAKRV
YWVDSRYDYIETVTYDGIQRKTVMHGGSLIPHPFGISLFESHVFYTDWTKMAVMKANKFR
ETNPRMLYKTSLNPYGVTVYHALKQPYASNPCKQDNGGCEQICVLSHRTDNNGLGFRCKC
TFGFQLDADGLHCAAVQNFLLFSSQRTVRGIPFTLSTQEDVMVPVTGSSSFFVGIDFDAR
SSTVFFSDISEHLIFEQKIDGTGREILVPNRVENVESLAFDWISRNLYWTDSHYKSVSVM
RLADKSRRTIVPLLSNPRSIVVHPVAGYIFFSDWFRPAKIMRAWGDGSHLLPIVNTTLGW
PNGLAIDWDALRLYWVDAFFDKIEHSTFNGLDRRILSHIEEMTHPFGITLFKEYVFFTDW
RLNAIVRVRKTDGGDKTVIRSGITMALNLKSYDVNVQTGSNSCNKPTHPNGDCSHFCFPV
PALQRVCGCPYGMKLAANHLTCEGDQSSEPPLEPCGEFSFLCNNSRCLSDVLVCNGVDDC
HDNSDELHCMLPNNTCPRMMFACAHGGECIPEVWHCDRYKDCVDGSDEQNCPTRRPILCP
ESQYTCDNHNCIPKNWLCDTDNDCGDGSDEKNCTSTEMCQPSQFTCPNHRCIDLSFVCDG
DKDCADGSDEFGCVLNCTASQFKCVSEEKCIPITNHCDGVFDCSDNSDEAGCPTRPPGMC
HSNEFQCQEDGICIPKTWECDGHPDCLSGSDEHHGCVPKTCHSSHFRCDNGNCISREWLC
DEDNDCGDQSDERNCPTQPFQCPRGMWQCPGYNFCVKLESVCDNVFDCPSGTDESPLCNE
DLCSRFNGGCTHRCIQDSFGARCLCPPGYLLANDSKTCEDINECDIPGFCSQHCYNMRGS
FRCSCDNEYMLEGDGKTCKVTGSESLLLLVASQNRIIADNVTSQVHSVYPLIQDGSHIIA
VDFDSVTGRIFWSDAIQRKTWSAFPNGTDRRVVFDSNVVLTETLAVDWVGRNLYWTDYAL
ETIEVAKIDGSHRTVLISKNVTNPRGLALDPRMNEHVLFWSDWGQHPRIERASMDGTSRT
VIIQNKIHWPSGLTIDYPNRLLYFMDAYLDYIDYCDYNGHHRKQVIASDLILQRSYALTL
FEDFVYWSNGVTQRVMQANKWHGGNQSVLMFNVPRPLGIVAVHPSKQPSSENPCASARCS
HLCLLSSQGPNFYSCVCPSGWTLSADSVNCLRDEQPFLITVRENIIFGISLNPDVKSNDA
MVPIAGVKNGYDVEFDDSEQYIYWAENPGEIHRVKTDGTNRTEFASLSMLGSSTGLALDW
ISGNLYTTNPGTQSIQVSTLRGDTRYRKTLITNDGTALGVGYPIGIAVDPARGKLYWSDQ
GTDSGVPAKIASASMDGTSLKNLFLGNLDHLESLTLDIKEQKLYWAVTGTGVIERGNVDG
TERMILVYQLSHPWGVAVFDSFLYYCDEHYEAIERVDKHTGANKVVLRDNIPNLRGLRVY
HRRNAAESSNGCSQNRNACQQICLPVPGGAFSCACATGFQLNPDYRTCSPHNSFIVVSML
TAIRGFSLSLLDHSEAMVPVAGQGRNVLHADVHVSSGFIYWCDFSSSVRSYNAIRRIKPD
GSSLTNIVTEGIGETGIRGIAVDWVAGNLYFTNAFAYETLIEVLRINTTYRRVLLKATVD
LPRHIIVDPKNRYLFWADYGQNPKIERSFLDCTNRTVLVSDGIVSPRGLAIDHSSGYIYW
VDDSLDLIARIHFDGEETQVIRYGSRYPTPYGITVFGNSIIWVDRNLKKVLQASKEPGRT
DPPIVIRDNMYWLRDVTVFDEQVQPRSPAEVNNNPCLENNGGCSHFCFALPGLHTPQCGC
AFGNLESDGKSCTISTENFLAFALANSLRSLHLDPENHSPPFQPINMEKPPIALAYDSIN
NRIYFTQSVNFFDGQISYVSLSSGIHTPTVITSDIGTSDGIAYDWINRRIYYSDYFNETI
NSISEDGTQRTVIARVAKPRAIVIDPCRGYLYWADWNGNAKIERATLGGNFRVPIVTSNL
VWPKGLTLDYEEDLLYWADASLRQIERSTLTGTQREVLVSAAFHISSLAVFGQYIYWTDM
STRKIYRANKYDGEDMPFNIIALQILLRRESHCYFRCRCKGYSGGDSCYTLVFHFFFSSG
PNGAECQCPHEGNWYLANNNKLCIVDNGIRCNVSQFTCANGRCILEGWKCDGDNDCGDGS
DEAEYVCAFHTCSPTAFTCANGRCVPYYYRCDFYNDCADGSDEAGCLFRDCNATTEFTCN
NRRCIPREFVCDGRDNCRDNNTSDERNCPHRTCPSGYTKCQNTNICIPRLYLCDGDNDCG
DMSDENPTYCTINTCSSSEFRCSSGRCIPQRWYCDQEDDCGDGSDEPATCEHPERTCPSD
DFKCDNGRCISRHWICDSDNDCGDMSDEDERHHCENRNCTSSEFWCVNSSPPARKCIPQT
WVCDGDADCADGYDERQNCTRSSCSENEFTCSYGLCIPSSFRCDRHNDCGDYSDERDCLY
QTCQAHQFTCQNGRCIFRDFVCDEENDCGDGSDELDHLCHTPEATCPPHYFRCNNGHCVE
MEKLCNHYDDCSDNSDEKGCGINECSDPSSSGCDHNCTDTIVSFFCSCLPGYKLMSDKRT
CVDIDECKERPFVCSQRCENEIGSYICKCDPGYIREPDGRSCRQTSSIEPYLIFSNRYYL
RNLTVDGSFYSLILQGLGNAVALDFDRVEERLYWIDEEKGVIERMFLNKTDRETIISYKL
QNPQGLAVDWVSRKLYWLDSSLKGLFVSDLNGDRHRKLAQHCVDLNNTFCFDYPRGIVLH
PKYGYVYWTDWTHRAYIGRVGMDGTNKSVIISTKIMRPNGITIDYTNDLLYWTDSHLGYI
EYSDLEGHNRHPVYDQTLPYPFAVTIFEDTIYWTDWNTRTVEKGNKYHGSNRVVLVNTTH
RPFDIHVYHPYRQPKVDNPCGTNNGGCSHLCLIKEGGKGFTCECPDDFNTVFWHGETYCI
PACSSTQFLCANEEKCIPIWWKCDGQRDCSDGSDESAHCPQRFCRIGQFQCKDGNCTSPQ
TLCNARPDCPDGSDEVSSLCENHKCESNEWQCANKRCIPEHWQCDTLDDCGDNSDEDRSH
CASRTCKPGQFKCDNGHCIPQSWKCDVDNDCGDYSDEPVQECLTPAYRCNNLTEFSCKTN
YRCISKSAVCNGFDDCRDNSDEQGCEERTCHPSGDFRCKNHVCIPLRWKCDGEDDCQDNS
DEEGCVPRECTESEFRCPDQQCIPSQWLCDHYDDCGDNSDERDCELRTCHPDYFQCASGH
CIPQDWKCDGAADCHDASDESTCPTRFPNGTYCQANMFECKNHVCIQLNWKCDGDNDCGD
GSDEELHLCSDVPCESPDRFRCDNNRCIYSSKLCNTVDNCGDGSDERAEHCHEPTHKPCT
ENEFKCDNGLCIPQDNVCDDVNDCGNYFDETGCNVGKERTCAEKICEQNCTQLNVGGFIC
SCRSGFKVGAVDRNSCEDINECEEFGICSQKCRNTKGSYECLCADGFRSVSEDFGKRCAA
EGDSPLLLLPDNVRIRKYNLTSERFSEYLQDEEHIQALDYDWDPEGIGLSVVYYTVRGQG
SGFGAIKRAYIPNFESGNNNLVQEVDLKLKYVFQPDGLAVDWVGRHIYWSDVKNQRIEVA
KLDGRYRKWLVTSSLDQPAAIAVNPKLGLMYWTDWGKQPKIESAWMNGEHRTVLVSNYLG
WPTGLTIDYLNDDRIYWSDFKEDIIETMKHDGTVRRVVSHGAMKPYSLDIFENHLYWISK
EKGEVYKQDKFGQREKEKILVLNPWLTQARIFHQLRYNHSVPNRCKNTCSHLCLLRPGGY
SCACPQGSNFIKGSTTECDAAIELPIPMPAPCRCMYGGNCYFEEKDLPKCKCLSGYTGKY
CEIAFSKGVPPGTTAVATLLTLLLIIIIGGLAVVGFFHYRKTGSLLPALPKLPSLSSLVK
PSENGNGVTFRSGADFNMDIGISDLGPESAIDRSMAMSEDFVMEMGKEPIIFENPMYATK
DSAVKVVQPTQGPSMCPQVTVSRNVDNMNYGSPISPSEIVPEIKPTSPGADETQVTKWNI
FKRKPKQTTNFENPIYAEMENMPRESVATTPPPSPSPPPKISSKRDPTPTYTPTEDTFKD
TANLVKEDSEA
Download sequence
Identical sequences H0WXB6
ENSOGAP00000007084 ENSOGAP00000007084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]