SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007122 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007122
Domain Number 1 Region: 415-526
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 596-703
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-20
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 3 Region: 709-774
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 768-830
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 835-895
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000354
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 355-420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000375
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 239-356
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000105
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 
Domain Number 8 Region: 531-595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000135
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007122   Gene: ENSOGAG00000007954   Transcript: ENSOGAT00000007957
Sequence length 993
Comment pep:known_by_projection scaffold:OtoGar3:GL873631.1:1237615:1268368:1 gene:ENSOGAG00000007954 transcript:ENSOGAT00000007957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLNALSKEMDLLLHGLGLSSQAPTMEKGQAPGIEETDGELTAAPTPEQPERGVHFVTTA
PTLKLLNHHPLLEEFLQEGLEKGEEELKPALPFQPDPPTPFTPSPLLRLANQDSRPVFTS
PTPAMAAAPTQPHSREGPWILESGPPVLHITAPLPPGPSMAVPTLGPGERPSSTSPSRAW
TPTQEGPGNLGRPWDPEVVSQPTGLGIEGIIATSTASGDDEETTTTTTIITTTITTVRSP
GPCSWNFSGPEGSLDSPTAPGSPPDVGLDCFYYISVYPGYGVEIKVQNISLQEGETLTVE
GLGGPDPLPLANQSFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLSCHFPR
RPAYGDVTVTSLHPGGSARFHCATGYQLKGARLLTCLNATQPFWDPQEPVCIAACGGVIR
NATTGRIVSPGFPGNYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEA
PPVYDSYEVEYLPIEGLLSSGRHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGN
FSSSAPSYPVGTTVEFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRAVCSGEITDSA
GVVLSPNWPEPYGRGQDCIWGVHVEEDKRIMLDVRVLRIGPGDVLTFYDGDDLTARVLGQ
YSGPRGHFKLFTSMADVTIQFQSDPGTSVMGYQQGFVIHFFEVPRNDTCPDLPEISNGWK
SPSQPELVHGTVVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVEHSR
RLISSSKFPVGATVQYICDQGFVLTGSSILTCHDRQAGNPKWSDRAPKCLLEQLKPCHGL
SAPENGARNPEKRLYPAGATVHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASLD
GFYSSRSLDVAKAPAASSTLDAAHIAAAIFLPLVAMVLLVGGVYLYFSRLQGKSSLQLPR
TRPRPYNRITVESAFDNPTYETGSLSFSGDERI
Download sequence
Identical sequences H0WXE5
ENSOGAP00000007122 ENSOGAP00000007122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]