SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007780 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007780
Domain Number 1 Region: 910-1200
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.5e-55
Family Complement components 0.0000858
Further Details:      
 
Domain Number 2 Region: 1281-1409
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 8.63e-32
Family Alpha-macroglobulin receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 745-798
Classification Level Classification E-value
Superfamily E set domains 0.0000000014
Family SVA-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007780   Gene: ENSOGAG00000008674   Transcript: ENSOGAT00000008682
Sequence length 1444
Comment pep:known_by_projection scaffold:OtoGar3:GL873626.1:7049063:7164091:-1 gene:ENSOGAG00000008674 transcript:ENSOGAT00000008682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGARLRTAAQLLCLCAAALAAAPGPQFLVTAPGIVRPGANITIGVDLLEHSPPQVTVKA
ELFQVASNLSVSVLEGEGVFERGSFKTLILPSLPLNSPNKIYELHVTGRAQDEILFSNRT
RLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWL
AQQSVLGVVSKTFQLSSHPILGDWSIQVQVNDQLYYQSFQVSEYVLPKFEVTLQTPLYCY
MNSKNLNGTVTAKYTYGKPVKGDVTLTFLPLSFWGVKKNITKKFEINGSANFSFNDEEMK
NVMDFSNDLSEDMEMSLPGPVEIFATVTESLTGISRNASSNVFFKQHEYIIEFFDYPTVL
KPSLNFTATVKVTRFDGNRLTVEERRNNMVLTVTQRNYTEHWSKWNMGNQRGEAIQIINY
TIPENGMVKVEFPVLDDSSQLQLKAYFLESTSNMAVHSMFTSPTKTYLQLTTRDENDVLF
QVGSPFELVVTGNGWLKELSYMVVSKRQLVAVGKQNSTTFSLTPENSWAPKACIIVYYVE
DNGEIINAVLQITVQLVFKNKIKLFWSNANARPAEKVSLRISVTQPGSIVGIVAVDKSVN
LMNASNDITMENVVQDLELYNTGYYLGMFMNSFAVFQECGLWVLTDANLIEDYTDIAFDS
MLYAENFVEESNAVDLDDFSSISIPRVRKHFPETWIWLDTNMGYTFINMQSYDLVMTHSL
RNWYVLFFCINCLNSFNFSSTAVKLQAFQPFFIFLNLPYSIIRGEEFVLEVTIFNYLKDA
TEVKVNIEESDKFDILMTSNEVNASGHQQTIGVPSEDGATVLFPIKPRHLGEIPITVTAV
SPTASDALTQKILVKAEGIEKSYSQSVLLDLTDNKLQSTMKTLSFSFPPDTVSGSERVQI
TAIGDVLGFSIHGLASLIRMPYGCGEQNMINFAPNIYILDYLTKKRQLTDTLKEKALSFM
RQGYQRELLYQREDGSFSAFGDDDPSGSTWCFLGVLRFHFGSAGGSADILQQWPWHQLVG
GSSLSLSVGVIWGIGNVYQTKVCAGFKPATLVIYIYIYFFFPSSKPNIDVQDSINFLEAE
FSRGISDNYTLALITYALSSVGSPKAQEALNVLTQRAEHEEGTRFWVSSASKLSDSWQPR
SLDIEVAAYTLLSHFRQFQLSEGIPIMKWLSSQRNSLGGFASTQDTIVALKALSEFAALM
NTERTDIQVTVMGPSSPSPVKFLIDAHNRFLLQTAELAVLQPMDINISASGFGFAICQLN
VVYNVKDSGSSRRRRSISNQEAFDLDVTVKDNKDDANHVNLNVCTRFRGPDRSGMALMEV
NLLSGFTVPSDAIPLSQTVKKVEHDHGKLNVYLDSVNETQFCVDIPAVRSFKVSNTQDAS
VSIVDYYEPRRHAVRSYNAQAKLSSCDLCRDVQGCSPCADGASEGSSVLFTLCLALLFSV
QHWP
Download sequence
Identical sequences H0WZ02
ENSOGAP00000007780 ENSOGAP00000007780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]