SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008318 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008318
Domain Number 1 Region: 761-1013
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-42
Family YWTD domain 0.0000124
Further Details:      
 
Domain Number 2 Region: 108-266,429-603
Classification Level Classification E-value
Superfamily Sialidases 7.06e-31
Family Sialidases (neuraminidases) 0.068
Further Details:      
 
Domain Number 3 Region: 1561-1746
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-26
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 4 Region: 1936-2109
Classification Level Classification E-value
Superfamily Fibronectin type III 6.4e-17
Family Fibronectin type III 0.0051
Further Details:      
 
Domain Number 5 Region: 1418-1456
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 6 Region: 1197-1235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000681
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 7 Region: 1325-1361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000105
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1154-1195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 9 Region: 1077-1115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 1372-1405
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 1240-1273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 12 Region: 1512-1551
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 13 Region: 1751-1879
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000661
Family Fibronectin type III 0.0067
Further Details:      
 
Domain Number 14 Region: 1472-1509
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 15 Region: 1122-1155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 1277-1312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000327
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008318   Gene: ENSOGAG00000009277   Transcript: ENSOGAT00000009291
Sequence length 2216
Comment pep:known_by_projection scaffold:OtoGar3:GL873627.1:3214365:3378241:-1 gene:ENSOGAG00000009277 transcript:ENSOGAT00000009291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRSSRRESRLPFLFTLVALLPPWALCEVWTQRLHCDRAPLPQDRGFLVVQGDPRELRL
WARGDASGASRADEKPLRRRRSAALQQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVA
LARDSLALARPKSSDVYVSYDYGKSFKKISEKLNFGVGNSSEAVIAQFYHSPADNKRYIF
ADAYAQYLWITFDFCNTVQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQ
TWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRD
FQLRDKYMFATKVAHLLGGQQQPSVQLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQV
FVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEG
LQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQ
RLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHY
YTWGDHGGIIMAIAQGTETNELKYSTNEGETWKSFIFSEKPLFVYGLLTEPGEKSTVFTI
FGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHAT
CFNGEDFDRPVIVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVG
STYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAMRKSIHRYDLASGAT
EQLPLSGLRAAVALDFDYERNCLYWSDLALDIIQRFVNRNSSQGQQNILLSRSCLVEALA
FEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDL
KPGIYRSDMDGSAAHRLVSEDVKWPNGISVDDQWIYWTDAYLDCIERITFSGQQRSVILD
NLPHPYAIAVFKNEIYWDDWSQLSIFRASKYNGAQMEILASQLTGLMDMKIFYKGKNTGS
NACVPRPCSLLCLPKANNSRSCRCPEGVSSSVLPSGDLMCDCPRGYQLKNNTCVKEENTC
LRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLSYKC
DLEDDCGDNSDESHCEMHQCRRDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHT
CEASNFQCHNGHCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDG
LHDCSDGSDEQHCEPLCTRFMDFVCKNRQQCLFHSMVCDGIVQCRDGSDEDAAFAGCSQD
PEFHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFLCEN
GHCIPNRWKCDRENDCGDWSDEKDCGDSHILPSPTPGPSTCLPNYYRCSSGTCVMDAWVC
DGYRDCADGSDEEACPSLANVTSASTPTQPGRCNRFEFECQQPKKCLPNWKRCDGHRDCQ
DGRDEDSCPTHSTLTCMSREFKCEDGEACIVLSERCDGFLDCSDESDERACSDELTVYKV
QNLQWTADFSGDVTLTWMKPKKMPSASCVYNVYYRWVPSSLLDKKVMSPLVLDVYKLALK
PDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLHREAEGVIVGHWTPPLH
THGLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNALYSVRVAAVTSRGIGNWSDSK
SITTIKGKVIPPPDIHIDSYGENSLSFTLTMDGDIKVNGYVVNLFWAFDTHKQEKRTMNF
RGSILSHKVGNLTAHTAYEISAWAKTDLGDSPLAFEHVTTRGVRPPAPSLKAKAVNQTAV
ECTWTGPRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYLGP
SSDYVVVKMIPDSRLPPRHLHVVRTGKTSAVIKWESPYDSPDQDLLYAITVKDLIRKTDR
SYKVKSSNSTVEYTLNKLEPGGKYHVIVQLGNMSKDSSIKVTTVSLSAPDALKIITENDH
VLLFWKSLALKEKHFNESRGYEIRMFDSAMNITAYLGNTTDNFFKISNLKMGHNYSFTVQ
ARCLFGSQICGEPAVLLYDELGSGGDASAIQAARSTDVAAVVVPILFLILLSLGVGFAIL
YTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA
Download sequence
Identical sequences H0X091
ENSOGAP00000008318 ENSOGAP00000008318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]