SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008394 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008394
Domain Number 1 Region: 22-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.72e-49
Family Hypothetical protein AT3g04780/F7O18 27 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008394   Gene: ENSOGAG00000009373   Transcript: ENSOGAT00000009374
Sequence length 211
Comment pep:known_by_projection scaffold:OtoGar3:GL873675.1:244503:254209:1 gene:ENSOGAG00000009373 transcript:ENSOGAT00000009374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHGHSHGGGGCRCAAEREEPPEQRGLDYGLYLRIDLERLQCLNESREGSGRGVFKPWEE
RTDRSKFVESDADEELLFNIPFTGNVKLKGIIIMGENDDSHPSEMRLYKNIPQMSFDDTE
REPDQTFSLNRDLTGELEYATKISRFSNVYHLSIHISKNFGADTTKVFYIGLRGEWTELR
RHEVTICNYEASANPADHKVHQVTPQTHFIS
Download sequence
Identical sequences H0X0F6
XP_003799802.1.62490 ENSOGAP00000008394 ENSOGAP00000008394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]