SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009060 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009060
Domain Number 1 Region: 1377-1393,3401-3581
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-32
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 137-222
Classification Level Classification E-value
Superfamily Immunoglobulin 2.95e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 1691-1780
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 2947-3041
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-19
Family I set domains 0.007
Further Details:      
 
Domain Number 5 Region: 3028-3121
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-19
Family I set domains 0.0095
Further Details:      
 
Domain Number 6 Region: 3309-3396
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 7 Region: 3231-3318
Classification Level Classification E-value
Superfamily Immunoglobulin 1e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 1414-1507
Classification Level Classification E-value
Superfamily Immunoglobulin 2.2e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 9 Region: 2171-2259
Classification Level Classification E-value
Superfamily Immunoglobulin 5.63e-17
Family I set domains 0.039
Further Details:      
 
Domain Number 10 Region: 2370-2452
Classification Level Classification E-value
Superfamily Immunoglobulin 5.66e-17
Family I set domains 0.027
Further Details:      
 
Domain Number 11 Region: 1787-1871
Classification Level Classification E-value
Superfamily Immunoglobulin 6.08e-17
Family I set domains 0.058
Further Details:      
 
Domain Number 12 Region: 1508-1595
Classification Level Classification E-value
Superfamily Immunoglobulin 1.84e-16
Family I set domains 0.0000262
Further Details:      
 
Domain Number 13 Region: 2759-2854
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 14 Region: 2274-2356
Classification Level Classification E-value
Superfamily Immunoglobulin 5.57e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 15 Region: 2840-2938
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000119
Family I set domains 0.015
Further Details:      
 
Domain Number 16 Region: 2568-2649
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000139
Family I set domains 0.014
Further Details:      
 
Domain Number 17 Region: 1982-2073
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000014
Family I set domains 0.046
Further Details:      
 
Domain Number 18 Region: 3136-3227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000142
Family I set domains 0.026
Further Details:      
 
Domain Number 19 Region: 2663-2747
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000181
Family I set domains 0.057
Further Details:      
 
Domain Number 20 Region: 2080-2168
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000249
Family I set domains 0.07
Further Details:      
 
Domain Number 21 Region: 1890-1983
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000472
Family V set domains (antibody variable domain-like) 0.085
Further Details:      
 
Domain Number 22 Region: 1601-1688
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000769
Family I set domains 0.038
Further Details:      
 
Domain Number 23 Region: 99-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 24 Region: 1299-1351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000642
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 25 Region: 14-51
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000851
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 56-92
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 496-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 28 Region: 895-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000206
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 29 Region: 2468-2552
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000779
Family I set domains 0.069
Further Details:      
 
Domain Number 30 Region: 556-604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 31 Region: 1358-1406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 32 Region: 955-1000
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 33 Region: 1011-1058
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Laminin-type module 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000009060
Domain Number - Region: 622-662
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000204
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 1262-1301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family EGF-type module 0.084
Further Details:      
 
Domain Number - Region: 858-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0131
Family Laminin-type module 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009060   Gene: ENSOGAG00000010117   Transcript: ENSOGAT00000010140
Sequence length 3590
Comment pep:novel scaffold:OtoGar3:GL873528.1:3516915:3569142:1 gene:ENSOGAG00000010117 transcript:ENSOGAT00000010140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPSPQLLRPDLGRPLPCGPQEAACHSGHCIPKDYLCDGQEDCKDGSDELDCGPTPPCEPN
EFPCGNGHCALKLWRCDGDFDCEDRTDEADCPAKRPEEVCGPTQFRCVSTNTCIPASFHC
DEESDCPDRSDEFGCMPPQVVTPPQESIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIP
SHPRVTVTSEGDRGTLTIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELIPQRGPCPDG
HFYLEHSASCLPCFCFGVTNVCQSSHRFWDQIHLRFDRPDDFKGVNVTMPAQPGMPPLSS
TQLQIDPTSQEFQLVDLSRRFLVHDSFWALPEQFLGNKVDSYGGFLRYRVRYELARGMLE
PVQKPDVVLVGARYRLHSRGHVPTQPGTVNQRQVQFSEEHWVHESGRPVQREELLQVLQS
LEAVLIQTVYNTKMASVGLSNITMDTTVTHATRHGRAHSVEECRCPIGYSGLSCESCDAH
FTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKAGFFGDATKATA
TACRPCPCPYIDASQRFSNTCFLDTDGQATCDACEPGYTGRRCESCAAGYEGNPIQPGGK
CRPTNQEFVRCDERGSVETSGSSLQVACRCKNNVVGRLCKECANGFFHLGNRKSDGCLKC
FCMGVSRQCTSSSWSRAQVLGASEEPAHFSLTNAAGTHTTTDGISSPASGELVFSSFHHL
LPGPYFWSLPPRFQGDKVTSYGGELRFTVTQRPQPGSTPLHGQPLVVLQGNGIVLEHHTS
QEPIPGQPSTFTVPFWEQAWQRPDGQPATREHLLMALADINTLLIQASYTQHPAESRVSG
ISMDIAVPEDTGQDPALEVEQCTCPPGYRGPSCQDCDTGYTRMPSGLYLGTCERCSCHGH
SEVCEPETGVCQGCQHHTEGPRCEQCQPGYYGDAQQGTPQDCQRCPCYGAPASGQATHTC
FLDTDSHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCRRDGQMPEPIGCGCDPEGSIS
TQCDATGQCYCKTQVEGLTCNHCRPHHFHLSASNPDGCLPCFCMGVTQQCASSSYTRHLI
STHFAPGDFQGFVLVNPQRNSHLTGGFTVDPVPEGAQLSFGNFAHLGHESFYWQLPETYQ
GDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVASQPAVPGPQRKSYEIIFR
EEFWRRPDGQPATREHLLMALADLDELLVRATFSSMPLAASISAVSLEVAQPGPSDGPRA
HEVEECRCPPGYAGLSCQDCAPGYTRTGSGLYLGHCELCECNGHSDLCHAETGACSQCQH
NAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTACEPG
YTGQYCEQCAPGYVGNPNVQGGRCVPQTNQASLVVQVHPARSIVPQGGPHSLRCQVSGSP
PHYFYWSREDGRPLPSSTQQRHQGSELHFPSVQPSDAGVYICTCRNLHHVNTSRAELLVT
EAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPAYTLVWTRLHNGKLPARAMDFNGI
LTIRNVQPSDAGTYVCTGSNMFAMDQGTATLHVQASVTSSAPVVSIHPPQLTVQPGQLAE
FRCSATGNPMPTLEWTGGPGGQLPQKAQIQGGILRLPAAEPSDQAQYLCRAHSSAGQHVA
RAVLHVHGGSGPRVQVSPEKTEVQEGSTVWLYCRAAGVPSATITWRKEGGSLPPQARSER
TNIATLLIPAITTADAGFYLCVATSPAGTAQARIQVVVHAASRGSSPPVRIESSSPSVTE
GQTLDLNCVVAGSAHTQVTWYRRGGRLPPHAQVHGSRLRLSQVSPADSGEYVCRVENGSG
HKEASITVSVLHGTHSGPTQTPASGSTQPIRIEPSSSHVAEGQTLDLNCVVPGQAHAQVT
WHRRGGSLPAQHQTHGSLLRLYQVSPADSGEYVCRVVGSSVPQESSVLVTIEPSGSIPGP
VPPVRIESTSSTVAEGQTLDLSCVVAGQAHAQVTWYKRGGSLPARHQVRGSRLYIFHVSP
ADAGEYVCRASNGVEASITVTVTRTQGANFAYPPGSTQAIRIEPSSSHVAEGQTLDLNCL
VPGQPDAQVTWHKRGGSLPARHQTHGSLLRLNQVSPADSGQYVCRVVGGSVPLEASVLVT
IEPAGSVPTVGVTPPVRIESSSSHVAEGQTLDLNCLVAGQPHAQITWHKRGGSLPTRHQV
HGSRLRLLQVTPADSGEYVCHVVSSSGTQEASVLVTIQKRLGTSHSQSVVYPVRIESSSA
SLANGHTLDLNCLVASQAPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVS
NGAGSQETSLVVTIQGSGSSHGPSIFRPIRIESSSPTVVEGQTLDLNCVVSGQPQAVITW
YKRGGSLPPKHQIHGSHLRLHQMSMADSGEYVCRANNNIDALETSIMVSVSPGTSNPSVS
GSTMPIRIESSSSQVAEGQTLDLNCVVPGQAHAQVTXXXXXXXXPVPVQAHGSRLRLYQV
SPADSGEYVCRAVGSSGPLEASVLVTIEASGSSSVHVPVPGGATPIRIETSSSRVAEGQT
LDLNCLVPGQPHAQVTWHRRGGSLPARHQVHGTLLRLNQVSPADSGEYSCRVTGSSGTQE
ASVLVTIEASSPGPIPPPGLAQHVHIEATSSHVAEGQTLDLNCVVPGQAHAQVTWYKRGG
SLPAQHQTHGSQLRLHHVSPADSGEYVCRVAGGSGPQQEASFTVTVTPSEGSSYRLRSPV
ISIDPPSSTVRQGQDASFKCLIHEGAAPITLEWKTRNQELEDNVHISPNGSIITIVGTRP
SNHGAYRCVASNAYGVAQSVVNLSVHGPPTVSVLPEGPVRVKVGRAVTLECVSAGEPRSS
ARWTRVGTPVKLEQRMYGITTSLAFSQISSAEPSDAGTYVCLAQNALGTAQKRVEVIVDT
GTVAPGAPQVQVEETELTVEAGHTATLRCSATGSPMPTIHWSKLRSPLPWQHQVEGNTLI
IPRVAQQDSGQYICNATSPAGHSEATVILHVESPPYATIVPEHASVRAGERVQLQCLAHG
TPPLTFQWSRVGGSLPGRATTRNELLHFESVAPEDSGRYRCQVTNRVGLAEAFAQLVVQG
PSGSLPATPIPAGSTPTVQVTPQLETKSIGASVEFHCAVPSDPGTQLRWFKEGGQLPLGH
SVQDGVLRIQNLDQSCQGTYICQAHGPWGQAQASTQLVVQALPSVLINIRTSVQTVVVGH
AVEFECLALGDPKPQVTWSKVGGRLRPGIVQSGGIVRIAHVELADAGQYRCTATNAAGTT
QSHVLLLVQALPQISMPPEVRVPAGSAAVFPCMASGYPTPEITWSKLEGDLPPDSHLENN
MLMLPSVRPQDAGTYVCTATNRQGKVKAFAHLHVPERVVPYFTQTPHSFLPLPTIKDAYR
KFEIKITFRPDSADGMLLYNGQKRIPGSPANLANRQPDFISFGLVGGRPEFRFDAGSGMA
TIRHPTPLALGQFHTVTLLRSLTQGSLIVGSLAPVNGTSQGKFQGLDLNEELYLGGYPDY
SAIPKAGLSSGFIGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRDRPCQ
Download sequence
Identical sequences H0X210
ENSOGAP00000009060 ENSOGAP00000009060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]