SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009463 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009463
Domain Number 1 Region: 585-695
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 408-519
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-19
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 3 Region: 701-759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000256
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 238-345
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000262
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 5 Region: 761-823
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000667
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 829-888
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000113
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 349-410
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000012
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 524-588
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000526
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009463   Gene: ENSOGAG00000010569   Transcript: ENSOGAT00000010574
Sequence length 981
Comment pep:known_by_projection scaffold:OtoGar3:GL873557.1:1292123:1368695:1 gene:ENSOGAG00000010569 transcript:ENSOGAT00000010574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQDAHPERDLGPSSPYVLPSAALESSGLGTESPKERVAMAPPNPTGEELGELDLEGTVP
SAHHDTPVLSLLLPEEASTKHTLSPGKKLPLLKQLNSARKQLRPKATSTATVLRAGSQPA
PSGLGPLSSPTEKPHPAGDLDPVVASEGASEVPLWTEQKEGADPTTPAPLQISPFTSQPY
VAHTLPQEAPPEDASSTTLMDKGENELTGSASEESQETTTSTIITTTVITTEQVPALCSV
SFSDPEGYIDSSDYPPLPFNNFLECTYNVTVYTGYGVELQVKSVNLSEGELLSIRGVDGP
TLTVLANQTLLVEGQVIRSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCNFPRRPNSGD
VTVMDLHSGGMAHFHCHLGYELQGAKTLTCINASKPHWSSPEPICSAPCGGAVHNATIGR
VLSPSYPGNSNGSQFCVWTIEAPEGQKLHLHFERLSLHEKDRMMVHSGKTNKSALLYDSL
QTESVPFEGLLSEGNTIRIEFTSSQDRAASTFNIRFEAFEKGHCYEPYIQNGNFTTSDPT
YNIGTTVEFTCDPGHSLEQGPAIIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPN
WPEPYVEGEDCIWKIHVGEEKRIFLDIQFLNLSNSDILTIYDGDEVMPHILGQYLGNSGP
QKLYSSTPDLTIQFHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHMEL
VRGARITYQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPV
LLVGTTIQYTCNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGY
QILYKRLYLPGESLTFMCYEGFELMGEVTIRCILGQPSHWNGPLPVCKVNQDSFEHALEV
AEAAAETSLEGGNMALAIFIPVLIISLLLGGAYIYITRCRYYSSLRLPLMYSHPYSQITV
ETEFDNPIYETGETREYEVSI
Download sequence
Identical sequences H0X300
ENSOGAP00000009463 ENSOGAP00000009463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]