SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009608 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009608
Domain Number 1 Region: 233-486
Classification Level Classification E-value
Superfamily Caspase-like 1.64e-88
Family Caspase catalytic domain 0.0000000038
Further Details:      
 
Domain Number 2 Region: 98-189,231-261
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-27
Family DEATH effector domain, DED 0.0075
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily DEATH domain 7.65e-25
Family DEATH effector domain, DED 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009608   Gene: ENSOGAG00000010735   Transcript: ENSOGAT00000010739
Sequence length 488
Comment pep:known_by_projection scaffold:OtoGar3:GL873532.1:29780085:29798293:-1 gene:ENSOGAG00000010735 transcript:ENSOGAT00000010739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSTLLYRIAEEIGSDELASLKFLSLDHIPQKKQEPIEDALILFQTLQEKRMLEEGNLS
FLKELLFRIDRLDLLVKYLGTSKEEMVRELTEGTAQISAYRVMLFKIAEDLDKLELRSFK
FFLKKEIPKCKLEDDMTLLDIFIEMEKRVILGEGNLDLLKRICSQINRSLLKKITDYEEL
SRGRRLSFERSTEEFSNVLRCVSPLFVGEDSLRMLAISDCPREQDSASQASDKVYPMKSR
PRGYCLIFNNYDFSIARRKVEKLQRMKDRNGTHLDAEALNKTFSELHFEVVLYEDQTAKQ
ICEVLKSYQSMNHSDKDCFICCILSHGDKGIIYGIDGEEARIYELTSFFTGSRCPSLAGK
PKVFFIQACQGDNYQKGICVETDSEQHEAYLEMDVAFQNKYIPDDADFLLGMATVNNYVS
YRSPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSSKDDRKRLGKQMPQPTFTLR
KKLFFPLL
Download sequence
Identical sequences H0X3C0
ENSOGAP00000009608 ENSOGAP00000009608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]