SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010060 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010060
Domain Number 1 Region: 4-237
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.04e-78
Family Proteasome subunits 0.00000000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010060   Gene: ENSOGAG00000011233   Transcript: ENSOGAT00000011237
Sequence length 250
Comment pep:known_by_projection scaffold:OtoGar3:GL873531.1:24794907:24854577:-1 gene:ENSOGAG00000011233 transcript:ENSOGAT00000011237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERT
VRKICALDDHVCMAFAGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIATLKQKY
TQSNGRRPFGISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTE
EAIANDNEAIKLAIRALLEVVQSGGKNIELAIIRRNQPLKMFSAKEIELQVTEIEREKED
AEKKKSKKTV
Download sequence
Identical sequences H0X4E0
XP_012657490.1.62490 ENSOGAP00000010060 ENSOGAP00000010060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]