SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010350 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010350
Domain Number 1 Region: 229-381
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.6e-28
Family DnaQ-like 3'-5' exonuclease 0.00085
Further Details:      
 
Domain Number 2 Region: 547-663
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000376
Family Canonical RBD 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010350   Gene: ENSOGAG00000011564   Transcript: ENSOGAT00000011571
Sequence length 774
Comment pep:novel scaffold:OtoGar3:GL873563.1:1181090:1224576:-1 gene:ENSOGAG00000011564 transcript:ENSOGAT00000011571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPERERTGRNLKKGRKRRRAPNKLVGAAEALRARWDLEERQPEAKKARLSTILFAENCE
VTHGQLCELLKYAVLGKSSVPKPSWCQLFHQNHLNNVVVFVLQGMSQLHFYRFYLEFGFL
RKVFRHKFRLPPPSSNFLADIIGLQKKQTTGDLPKVMEGSLPSASSKATINLQNDPIIQK
YGCKKVGLTRCLLTKEEMKTFHFPLQGFPDCENFVPTKCNGIITDNSPLFGLDCEMCLTS
KGRELTRISLVTEGGCCIMDELVKPDNKILDYLTSFSGITKKILNPVTTKLKDVQRQLKA
LLPPDAVLVGHSLDLDLRALKMIHPYVIDTSLLYLREQGRRFKLKFLAKAILGKNIQCPD
RLGHDATEDARTTLELARYFLKYGPKKIAELNLERLASHQEMQAAGQEPKNATEIVQRSN
TSVLECLDSMGQKLLFLARETEAGELSSSKNCRTIRCLSNKEVLEQARVEIPLFPFSIVQ
FSFEPFSPILTEEMNKRVRINNTAVHIVYLTKFKKKNGLRSRKCIAVYKPLSTLVFVFIC
RIPHLCIQYEVLEAAQLAIESLDGILVESTCIKVQRPVTELTLDCDILVNELERDSENRG
TIYLSGVNETFKEHLLQQSNLFLGLEAVILPKDLKSGKQKKYCFLKFKTFGSAQRALNIL
TGKDWKLKGRHALTPRHLHAWLRGLPPESRRPPGVRVIPPPSEQQALQTLKVDHPKIAAW
RWGRKIGKLYHKLCPGTLCLILLPGTKSTHGSLSGLGLMGIKDEEESTTSTLCS
Download sequence
Identical sequences H0X527
ENSOGAP00000010350 ENSOGAP00000010350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]