SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010405 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010405
Domain Number 1 Region: 286-416
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-44
Family Regulator of G-protein signaling, RGS 0.000000151
Further Details:      
 
Domain Number 2 Region: 11-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-26
Family DEP domain 0.01
Further Details:      
 
Domain Number 3 Region: 221-277
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000484
Family Transducin (heterotrimeric G protein), gamma chain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010405   Gene: ENSOGAG00000011625   Transcript: ENSOGAT00000011631
Sequence length 677
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:12746845:12815169:1 gene:ENSOGAG00000011625 transcript:ENSOGAT00000011631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIRHQGQQYRPRMAFLQKIETLVKDMQNPETGVRMQNQRVLVTSVPHAMTGSDVLQWIV
QRLWISSVEAQNLGNFIVKYGYIYPLQDPKNLILKPDNSLYRFQQTPYFWPTQQWPAEDT
DYAIYLAKRNIKKKGILEDYEKENYDFLNKKMNYKWDFVIMQAKEQYKAGKERNKADRYA
LDCQEKAYWLVHRCPPGMHDVLDYGLDRVTDPNEVKKETITAVKKEIMYYQQALMRSTVK
SSVSLGGIVKYSEQFLSNDAIMSGCLPSNPWITDDTQFWDLNAKLVEIPTKMRVERWAFN
FSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGA
RRWINIDGKTMDITVKGLRHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKEMLAKAVE
PQETKKSASLPFMRRHLRSSPSPVILRQLEEEAKAREAANTVDITQPGQHLAPSPHLAVY
TGTCVPPSPSSPFSSSCRSPRRPFPSPGRFIRRPSSTICPSPIRVALESSSGLEQKGEPS
GSRIPNGSSEAEGSEASIHGPWRRSLPRAPPKARMALSLGRFLRRGCLASPVFARLSPKC
PPVSHGKVQPLGDMGQQLPRLKSKRVANFFQIKMDVPTDSGTCLMDSEDTGTGDASDQAI
EKEVICPWESLAQGKAG
Download sequence
Identical sequences H0X569
ENSOGAP00000010405 ENSOGAP00000010405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]