SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010430 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010430
Domain Number 1 Region: 22-265
Classification Level Classification E-value
Superfamily Caspase-like 6.73e-96
Family Caspase catalytic domain 0.000000000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010430   Gene: ENSOGAG00000011654   Transcript: ENSOGAT00000011657
Sequence length 266
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:8020566:8027899:-1 gene:ENSOGAG00000011654 transcript:ENSOGAT00000011657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKKKKNVTGQSVKTTRDRVPTYQYNMNFEKVGRCIIINNKNFDKVTGMAVRNGTDKDAEA
LYKCFRSLGFDVVVYNDCSCAKMQDLLKQASEEDHSNSACFACILLSHGEENLIYGKDGV
TPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVE
ADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNHRVARHFESQ
SDDPRFHEKKQIPCVVSMLTKELYFS
Download sequence
Identical sequences H0X590
ENSOGAP00000010430 ENSOGAP00000010430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]