SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010720 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010720
Domain Number 1 Region: 434-690
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-61
Family YWTD domain 0.000000943
Further Details:      
 
Domain Number 2 Region: 1348-1605
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-57
Family YWTD domain 0.00000311
Further Details:      
 
Domain Number 3 Region: 736-992
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-55
Family YWTD domain 0.00000132
Further Details:      
 
Domain Number 4 Region: 1043-1296
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-48
Family YWTD domain 0.0000031
Further Details:      
 
Domain Number 5 Region: 347-426,682-730
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000033
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 257-297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 7 Region: 221-259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 136-176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 9 Region: 61-99
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 10 Region: 1302-1347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000745
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 11 Region: 302-338
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 98-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 13 Region: 180-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 998-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000658
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 19-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000010720
Domain Number - Region: 1605-1643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000242
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010720   Gene: ENSOGAG00000011979   Transcript: ENSOGAT00000011987
Sequence length 1898
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:72056578:72096546:-1 gene:ENSOGAG00000011979 transcript:ENSOGAT00000011987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALTGPFLLCPGLASSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCM
LPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIRSLW
HCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESCPSAVP
APPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAG
WRCDGDADCDDQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENT
GSPQCASDQFLCWNGRCIGQRKLCNGANDCGDNSDESPQQNCRPRTGEENCSVNNGGCAQ
KCQMVRGTVQCTCHTGYRLTEDGRTCQDVNECAEEGYCSQGCTNSEGAFQCWCETGYELR
PDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDV
TLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKV
LLWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDY
AGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSAN
KFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTG
FRKISSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDHV
YWTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDG
SMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASDRQVIISSNLTWPNG
LAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGERIYWTDWQTKS
IQSADRLTGLDRETLQENLENLMDIHVFHRRRPPVSTPCAMENGGCSHLCLRSPNPSGFS
CTCPTGINLLPDGKTCSPGMNSFLIFARRIDVRMVSLDIPYFADVVVPINITMKNTIAIG
VDPQEGKVYWSDSTLHRISRANLDGSQHEDIITTGLQTTDGLAVDAIGHKVYWTDTGTNR
IEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSERTVLIN
NNLGWPNGLTVDKASSQLLWADAHTERIEAADLNGANRHTLVSPVQHPYGLTLLDSYIYW
TDWQTRSIHRADKGTGSNVILVRSNLPGLMDIQAVDRAQPLGFNKCGSRNGGCSHLCLPR
PSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNV
ISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDT
GRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERK
VLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPFALTQQDR
WIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHL
CFARALDFVCACPDEPDGRPCFLVPGLVPPAPGATSMSEKSPVLPNTLPTTLRSSTARTR
TSLENVEGRCSERNAQLGLCAHSNEAIPAAPGEGLHISYAIGGLLSVLLILMVIAALMLY
RHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIQKPAMYNQLCYKKEGGPDHNYTKEKI
KIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQ
EEQSECSSVHTAATPERRGSLSDTGWKHERKLSTESQV
Download sequence
Identical sequences H0X5X0
ENSOGAP00000010720 ENSOGAP00000010720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]