SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010780 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010780
Domain Number 1 Region: 3029-3287
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-57
Family YWTD domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 1269-1534
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-52
Family YWTD domain 0.00000195
Further Details:      
 
Domain Number 3 Region: 1892-2152
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-45
Family YWTD domain 0.0000114
Further Details:      
 
Domain Number 4 Region: 3911-4182
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-43
Family YWTD domain 0.00000555
Further Details:      
 
Domain Number 5 Region: 1584-1841
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-43
Family YWTD domain 0.0000254
Further Details:      
 
Domain Number 6 Region: 536-769
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-40
Family YWTD domain 0.0000105
Further Details:      
 
Domain Number 7 Region: 199-470
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-38
Family YWTD domain 0.0000854
Further Details:      
 
Domain Number 8 Region: 2201-2470
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-35
Family YWTD domain 0.0000284
Further Details:      
 
Domain Number 9 Region: 2917-3021,3280-3341
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-21
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1180-1261,1527-1579
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000004
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 11 Region: 848-890
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.0000883
Further Details:      
 
Domain Number 12 Region: 3608-3646
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000641
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 13 Region: 929-968
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 14 Region: 3648-3684
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 15 Region: 3690-3735
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 16 Region: 1013-1050
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0000983
Further Details:      
 
Domain Number 17 Region: 2693-2730
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 3369-3409
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 19 Region: 889-931
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 20 Region: 3488-3527
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 21 Region: 974-1011
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 22 Region: 23-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 23 Region: 3535-3572
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 24 Region: 2560-2600
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 25 Region: 1057-1097
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 26 Region: 2733-2767
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 2815-2851
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 28 Region: 3451-3486
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 29 Region: 2600-2639
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 30 Region: 2853-2892
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000942
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 31 Region: 3411-3449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000011
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 3331-3366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 2773-2807
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 34 Region: 142-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000466
Family EGF-type module 0.004
Further Details:      
 
Domain Number 35 Region: 3777-3813
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 36 Region: 2527-2568
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 37 Region: 71-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 38 Region: 3813-3899,4183-4224
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000235
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 39 Region: 802-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000038
Family EGF-type module 0.041
Further Details:      
 
Domain Number 40 Region: 1143-1178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 41 Region: 1106-1140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000694
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 42 Region: 2659-2689
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000127
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 43 Region: 1846-1896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000285
Family EGF-type module 0.012
Further Details:      
 
Domain Number 44 Region: 2155-2202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000016
Family EGF-type module 0.011
Further Details:      
 
Domain Number 45 Region: 3731-3768
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000209
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 46 Region: 4234-4269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000779
Family EGF-type module 0.042
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000010780
Domain Number - Region: 4273-4307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000309
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 486-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000645
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4307-4342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00184
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 2479-2539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00202
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4413-4452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00203
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 116-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00369
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 4344-4378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010780   Gene: ENSOGAG00000012030   Transcript: ENSOGAT00000012052
Sequence length 4607
Comment pep:known_by_projection scaffold:OtoGar3:GL873562.1:11519780:11600404:1 gene:ENSOGAG00000012030 transcript:ENSOGAT00000012052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTPPLLLLLPLLSALVAAAIDVPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKTQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELRGNCSRLGC
QHHCVPTLNGPTCYCNNSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGAFTCGCVEGYL
LQPDNRSCKAKNEPVDRFPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFIYANE
TVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTK
LVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE
NYLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHVYHQRRQPRVRSHACEN
DQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRG
MDMGAKVQDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDG
IHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNG
WMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFY
DRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGVGGAPPTVT
LLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGV
TCLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRF
KCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDD
CGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQF
KCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRW
RCDGDTDCMDSSDEKSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENC
ESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAP
GEGIVCSCPLGMELGPDNHTCQIQSYCARHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES
CRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDK
IYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTT
LLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLT
VDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNT
LAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRT
VSCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVL
DYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTN
KKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSG
QKGPVGLAIDFPESKLYWISSGNRTINRCDLDGSGLEVIDAMRSQLGKATALAIMGDKLW
WADQVSEKMGTCSKADGSGSVVLRNSTTLVMHMKVYDESIQLDHEGTNPCSVNNGDCSQL
CLPTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSG
TSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIY
WTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDG
TERMVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFS
VSVFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCA
VANGGCQQLCLYRGGGRRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNL
NAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSGRTTIVE
NVGSVEGLAYHRDWDTLYWTSYTTSTISRHTVDQTRPGAFERETVITMSGDDHPRAFVLD
ECQNLMFWTNWNEQHPSIMRAALSGANILTLIEKDIRTPNGLAIDHRAEKLYFSDATLDK
IERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVDI
PQQPMGIIAVAKDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQEDLTCRAV
NSSCRAQDEFECANGECINFSLTCDGVSHCKDKSDEKPSYCNTRRCKKTFRQCNNGRCVS
NMLWCNGADDCGDGSDEIPCNKTACAVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCS
ATDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNY
FACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCG
DGSDEAAHCEGKTCGPASFSCPGTHVCVPERWLCDGDKDCADGADESVSAGCLYNSTCDD
HEFMCQNRQCIPKHFVCDHDRDCADGSDESPECEYPTCGPNEFRCANGRCLSSRQWECDG
ENDCHDQSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDGSDERSCH
VNECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPCSQRCINTH
GSYKCLCVQGYAPRGGDPHSCKAVTEEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAV
ALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCD
KGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSSR
SVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLF
EDYVYWTDWETKSINRAHKTTGANKTLLISTLHRPMDLHVFHGLRQPDVPNHPCKVNNGG
CSNLCLLSPGGGHKCACPTNFYLGGDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCG
DHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKC
TNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCV
DGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQ
FRCKNNRCVPGRWQCDYDNDCGDNSDEESCRTGLGLKSFTLPGGRDVPRAESLCPPSWGL
SLPCPFPAPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCTPRCDMDQFQCKSG
HCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNS
DENPEECSRFTCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDGTDEEDCEPPTAQTPHCKD
KKEFLCRNQHCLTSSLRCNMFDDCGDGSDEEGCSIDPKLTSCATNASICGDEARCVHTEK
AAYCACRPGFHTVPGQSGCQDINECLRFGTCSQLCNNTKGGHLCSCARNFMKTHNTCKAE
GSEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESVRIDAMDVHVKAGRVYWTNWHTGT
ISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVYWTDSGRDVIE
VAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDN
IQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPVMAADSKRGLSHPFSIDVFEDYIY
GVTYINNRVFKIHKFGHSPLVNLTGGLSHASDVVLYHQHKQPEVTNPCDRKKCEWLCLLS
PSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTCNLQCFNGGSCFLNARRQPKCRCQ
PRYTGDKCELDQCWEYCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCAGHCANNSTCT
VNQGNQPQCRCLPGFLGDRCQYRQCSNYCENFGTCQMAADGSRQCRCSAYFEGPRCEVNK
CSRCLQGACVVNKQSGDVTCNCTDGRVAPSCLTCAGHCSNGGSCSMNSKMMPECQCPPHL
TGPRCEEQVISQQQAGHMASILIPLLLLLLLLLVAGVVFWYKRRVRGAKGFQHQRMTNGA
MNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKAGGGGRETLATEGSTWAPREPYIAL
QPTNFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
Download sequence
Identical sequences H0X625
ENSOGAP00000010780 ENSOGAP00000010780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]