SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011141 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011141
Domain Number 1 Region: 1285-1363
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 901-974
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000762
Family I set domains 0.054
Further Details:      
 
Domain Number 3 Region: 684-737
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000562
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1185-1262
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000306
Family I set domains 0.042
Further Details:      
 
Domain Number 5 Region: 397-457
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000693
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 455-512
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000112
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 1403-1461
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 8 Region: 549-603
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000837
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 1465-1522
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 10 Region: 53-101
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 11 Region: 737-797
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000445
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 12 Region: 797-828
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000432
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 13 Region: 1579-1634
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000379
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 14 Region: 319-379
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000497
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 15 Region: 626-681
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000068
Family TSP-1 type 1 repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011141   Gene: ENSOGAG00000012437   Transcript: ENSOGAT00000012447
Sequence length 1670
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:34173190:34523484:-1 gene:ENSOGAG00000012437 transcript:ENSOGAT00000012447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTTAEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRYDDQTSRNARSEEEKDGNWDAWG
AWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSNHDCPPDAEDFRAQQCSAYNDVQ
YQGRYYEWLPRYNDPVAPCALKCQARGQNLVVELAPKVLDGTRCNADSLDMCISGACQAV
GCDRQLGSSAKEDNCGVCAGDGATCRLVRGQSKSHVSPEKREENVIAVPLGSRSVRITVK
GPAHLFIESKTLQGSKGEHSFNNAGVFVIENTTVEFQKGSERQTFKIPGPLTADFIFKTR
YTVARDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQLNSAECVDIRLKRVVPDHYCHY
YPENVKPKPKLKECGMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRS
FVCVEESMHGEVLQVEEWKCMYAPKPKVMQTCNLFDCPKWIAMEWSQCTVTCGRGLRYRV
VLCINHRGQHVGGCNPQLKLHIKEECIIPIPCYKPKEKSPVEAKSPWLKQAQELEETRIA
TEEPTFIPEPWSACSTTCGPGIQVREVKCRVLLTFTQTETELPEEECEGPTLPTERPCLL
EVCDESPGSQELDSPLHEDGEMTYDWEYAGFTPCTATCLGGRQEAIAVCLHIQTQQTVND
SLCDTVHRPPAMSQACNTEPCPPRWHLGSWGACSATCGVGIQTRDVYCLHPGESPAPPEE
CRDEKPHALQACNQFDCPPSWHIEEWQQCSRTCGGGTQNRRVTCRQLLTDGSFLNLSDEL
CQGPKASVHKSCARTDCPPHWAVGDWSKCSVSCGAGIQKREQVCQRMTAKGRRVPLSETV
CGDLPGLPLERSCQMPVCRKMKPEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRA
YLLPNTSVIIKCPVRRFQKSLIRWEKDGHCLQNSKRLGVTKSGSLKIHSLAATDIGVYRC
IAGPAQQTAVLKLIGTDNRLIAHPALPEHLRAYPGMDHKEANDLGVTWHKMRQMWSGKHE
LYLGDGQIHNQSFLRALLGHCSHSEGNTNSWEFKDKQFEAAVKQGAYSMDAAQFDELIRN
MSQLLETGEVSDDLASQVIYQLVAESAKVQPTPRQWTGIQEEVAPAIQLKGGTESGRQST
NAKNSGKLTFKPKGPVLMRQSHPPSVSFNKTINSRIGNIVYITKRTEVINILCDVITPSE
ATYTWTKDGALLQPSVKIILDGTGKMQIRNPTRKEQGIYECTVADRHGSDVESSSVLYAE
APVILSIERNITKPEHNHLSIVVGGTVEAALQANVTIRCPVKGAPQPNITWLKKGGSLSD
SVSLLFNGSLLLQNVSLENEGTYICTATNALGKAVAASVLHLLERRWPESKTAFPKGHKQ
SVLKASNSGTNSNGPTGEPLLQEPVWEPGNWSHCSATCGHLGVRIQRPRCVMANGQEVSE
TMCDHLQKPLAGFQPCNIQDCPARWLTSVWSECSVTCGKGFHSRQVTCKQTGAEGMVQVV
SPAACARRERPLGRKPCSVHPCAPREPGFQCPGHCRGHGVRMQQRHTACQHHNSSDSNCD
NRRRPTLRRNCASGACDTCWRAGPWRPCTAACGRGFQSRKVDCLHTRSCTPVAERHCVQK
KKPASWRHCLGPSCDRDCTDTTHYCMSVKRLNLCSLPLYRQRCCQSCREG
Download sequence
Identical sequences H0X6X6
ENSOGAP00000011141 ENSOGAP00000011141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]