SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011210 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011210
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 6.28e-40
Family Rap30/74 interaction domains 0.00000059
Further Details:      
 
Domain Number 2 Region: 175-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.52e-24
Family DNA-binding domain from rap30 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011210   Gene: ENSOGAG00000012517   Transcript: ENSOGAT00000012520
Sequence length 249
Comment pep:known_by_projection scaffold:OtoGar3:GL873562.1:3167189:3326116:1 gene:ENSOGAG00000012517 transcript:ENSOGAT00000012520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKAPGRGEVGKLRIAKNQGRTEVSFTLNE
DLANIHDIGGKPASVSTPREHPFVLQSVGGQTLTVFTESSTDKLSLEGIVVQRAECRPAA
SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVGYLKEILKEIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD
Download sequence
Identical sequences H0X740
ENSOGAP00000011210 XP_003790402.1.62490 ENSOGAP00000011210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]