SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011700 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011700
Domain Number 1 Region: 281-400
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.16e-24
Family Regulator of G-protein signaling, RGS 0.003
Further Details:      
 
Domain Number 2 Region: 493-626
Classification Level Classification E-value
Superfamily PX domain 6.41e-22
Family PX domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011700   Gene: ENSOGAG00000013059   Transcript: ENSOGAT00000013064
Sequence length 840
Comment pep:known_by_projection scaffold:OtoGar3:GL873580.1:2279023:2348573:-1 gene:ENSOGAG00000013059 transcript:ENSOGAT00000013064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKALKEVFDYSYRDYILSWYRSLSRDEGQLYHLLLEDFWEIARELHHRLSHVDVVKVVC
NDVVRTLLTHFCDLKAANARHEEQPRPFVLHACLRNSDDEVRFLQMCSRVLVSCLLPSKD
VQSLSLRVMLAEILATKVLKPVVEFLSNPDYINQMLLAQLEYREQINEHHKRAYTYAPSY
EEFIKLINSNSDVEFLKQLRYQIVVEIIQATTISSFPQLKRHKGKETAAMKADLLRARNM
KRYINQLTVAKKQCEKRIRILGGPAYEQQEEGSWDEGEGPQSQKILQFQDILANTFYRKH
FRMYMERMDKRALISFWESVEHLKSANKNEIPQLVGEIYQNFFVESKAISVEKSLYKEIQ
QCLVGNKGIEVFCKIQGDVYETLKDRYYPSFIVSDLYEKLMIKEEEKHASQLIPNKNEMS
PRDEAGEEAVEGGTSMINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLK
DEIILIEKERADLQLHMARTDWWCENLGMWNAAITSGEITEENGEQMPCYFVMVSLQEVR
GVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNK
FLQNLLSDERLCQSEALYAFLSPSPDYLKVIDVQGKKTTFSLSSFLERLPRDFFSHQEEE
TEEDSDLSDYGDDVDGRKDSLAEPCFMLIGEIFELHGMFKWVRRTLIALVQVTFGRTINK
QIRDTVNWIFSEQMLVYYISVFRDAFWPNEKTAPLTASRSQEQCQETKQRAQQKLLENIP
DMLQSLVGQQNARHGIIKIFNALQERRANKHLLYVLMELLLIELCPELRSHLDQLKAGQV
Download sequence
Identical sequences H0X8A8
ENSOGAP00000011700 ENSOGAP00000011700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]