SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011820 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011820
Domain Number 1 Region: 827-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000558
Family Laminin-type module 0.0000618
Further Details:      
 
Domain Number 2 Region: 723-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000586
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 3 Region: 285-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 4 Region: 883-931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000187
Family Laminin-type module 0.00018
Further Details:      
 
Domain Number 5 Region: 934-984
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 6 Region: 446-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000193
Family Laminin-type module 0.0093
Further Details:      
 
Domain Number 7 Region: 397-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 772-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Laminin-type module 0.00024
Further Details:      
 
Domain Number 9 Region: 341-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 10 Region: 982-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000019
Family Laminin-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000011820
Domain Number - Region: 1080-1303
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000157
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 
Domain Number - Region: 1285-1526
Classification Level Classification E-value
Superfamily Tropomyosin 0.000543
Family Tropomyosin 0.00062
Further Details:      
 
Domain Number - Region: 99-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00319
Family Galactose-binding domain 0.04
Further Details:      
 
Domain Number - Region: 686-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family Laminin-type module 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011820   Gene: ENSOGAG00000013185   Transcript: ENSOGAT00000013194
Sequence length 1608
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:10699757:10826840:-1 gene:ENSOGAG00000013185 transcript:ENSOGAT00000013194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSQRAAPALRLRGHLWPVLVVLAAAAATCAWAAMDECTDEGGRPQRCMPEFVNAAFNV
TVVATNTCGTPPEEYCVQTGVTGVTKSCHQCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGS
CENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECIKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRST
GHGGHCTNCRDNTDGANCDRCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGFHSLTEAGCRPCSCNPSGSIDECNVETGRCVCKDNVEGFNCERCKPGY
FNLESSNPRGCTPCFCFGHSSVCTNAIGYSVYSISSTFQIDEDGWRVEQRDGSEASLEWS
SERQDIAVISDSYFPRYFIAPAKFLGKQLLSYGQNLTFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYS
ERSAGYLDDVTLTSARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPC
VLCVCNGHSETCDPETGVCNCRDNTAGPHCEKCNDGYYGDSTVGTTSDCQPCPCPGGSSC
AVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKDGFYGNPLAPNPADKCRACSCNPYGTVKQQSRCNPV
TGQCECLPHVTGRDCGSCDPGFYNLQSGQGCERCDCHALGSTDGQCDIRTGQCECQPGIT
GQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKGDGRCECREGFVGHRCDQCEENYFY
NRSWPGCQECPACYRLVKDKVADHRVKLQELENLMANLGTGEEVVTDQAFEDRLKEAERE
VMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARARVENT
EQLIEIASRELEKARVAAANVSVTRPESPEDPNNMTLLAEEARKLAERHKQEADDIVRVA
KTANDTSTEAYNLLLKTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAG
DKAVEIYASVAQLTPVDSQALENEANKIKKEAEDLDRLIDQKLKDYEDLREDMREKELEV
KNLLEKGKIEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLNDFDRRVNDNK
TAAEEALRKIPAINQTIAEANEKTREAQLALGNAAEDATEAKRKAHEAERIASAVQKNAT
STKAEAERTYAEVTDLDNEVNSMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEI
NARKAKNTVTSLLNEINDLLERLGKLDTVDLNKLNEIEGTLSKAKDEMKVSDLDRKVSDL
ENEARKQEAAIMDYNRDIEEIMKDIRNLEDIKKTLPSGCFNTPSIEKP
Download sequence
Identical sequences H0X8J1
XP_003785688.1.62490 ENSOGAP00000011820 ENSOGAP00000011820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]