SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011932 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011932
Domain Number 1 Region: 443-700
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-49
Family YWTD domain 0.000000106
Further Details:      
 
Domain Number 2 Region: 234-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000144
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 3 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000314
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 4 Region: 149-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 5 Region: 272-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000055
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 6 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00052
Further Details:      
 
Domain Number 7 Region: 353-436,698-751
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000738
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 8 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 9 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 10 Region: 318-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011932   Gene: ENSOGAG00000013312   Transcript: ENSOGAT00000013317
Sequence length 873
Comment pep:known_by_projection scaffold:OtoGar3:GL873525.1:24109097:24141172:-1 gene:ENSOGAG00000013312 transcript:ENSOGAT00000013317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSARWALWLLLALCWAPRESGATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCAD
GSDEKNCVKKTCAESDFVCNNGQCIPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISC
GARSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQDDCN
DGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
ASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSLTCRPDQFECEDGSCIHGSRQCNGI
RDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHVNEC
LVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLIEQLRNTVALDADIAA
QKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVA
TLDGTKRKFLFNSGLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTVDIQ
WPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWI
DGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELIQPSGKNWCEEDAKNGGCEYLCL
PAPQINDHSPKYTCSCPNGYNLRENGRECQSTAPTVTYSETKDTNTTEISPTSGLVPGGI
NVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKT
TEEDLSIDIGRHSASVGHTYPAISVVSTDDDLA
Download sequence
Identical sequences H0X8U3
ENSOGAP00000011932 XP_003782961.1.62490 ENSOGAP00000011932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]