SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011952 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011952
Domain Number 1 Region: 380-640
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-55
Family YWTD domain 0.0000000175
Further Details:      
 
Domain Number 2 Region: 81-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 208-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 175-210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 5 Region: 1-43
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 6 Region: 121-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 34-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 8 Region: 296-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000272
Family EGF-type module 0.0032
Further Details:      
 
Domain Number 9 Region: 332-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.0016
Further Details:      
 
Domain Number 10 Region: 253-290
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 11 Region: 651-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000213
Family EGF-type module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011952   Gene: ENSOGAG00000013332   Transcript: ENSOGAT00000013339
Sequence length 886
Comment pep:known_by_projection scaffold:OtoGar3:GL873585.1:384498:458816:-1 gene:ENSOGAG00000013332 transcript:ENSOGAT00000013339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CMDSDFTCDNGHCIPERWKCDGEEECSDGSDESEATCTKQVCPAEKLSCGPTSHKCVPAS
WRCDGEKDCEGGADEAGCATSVCAPHEFQCSNRSCLAAVFVCDGDDDCGDGSDERGCADP
ACGPREFRCGGDAGACIPERWVCDRQFDCEDRSDEAAELCGRAGPGATSAPAACAAAAQF
ACRSGECVHLGWRCDGDRDCKDKSDEADCPLGTCHGDEFQCGDGTCVLAIKRCNQEQDCP
DGSDEAGCLQESTCEGPRKFQCKSGECVDGGKVCDAQKDCRDWSDELLKECGLNECLHNN
GGCSHICTDLKMGFECTCPTGFRLLDEKTCGDIDECEDPDACSQICVNYKGYFKCECHPG
YEMDILTKNCKAVAGRSPSLIFTNRHEVRKIDLVKRDYSRLIPMLKNVVALDVEVATNRI
YWCDLSYRKIYSAYMDKASDPAEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVA
TVDGGRRCTLFSHNLSEPRAIAVDPLRGFMYWSDWGYQAKIEKSGLNGADRQTLVSDNIE
WPNGITLDLLTQRLYWVDSKLHQLSSIDFSGGNRKVLISSTDFLSHPFGIAVFEDKVFWT
DLENEAIFSANRLNGLEVSILAENLNNPHDIVIFHELKQPRAADACELSAQPNGGCEYLC
LPAPQTSSHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLASTTPGTVPATTRAPGTT
VHSPTYQNHSTETPSLAAAVPTSVSVPRAPSIILSTPSPATSNHSQHCKIHTHTLTRPWT
HSNEASFCKRLCFADGNEGGKMGSTVTAAVIGIIVPIAVIALLCMTGYLIWRNWKRKNTK
SMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAGQVVGLRSQIS
Download sequence
Identical sequences H0X8V9
ENSOGAP00000011952 ENSOGAP00000011952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]