SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012399 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012399
Domain Number 1 Region: 13-217
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.95e-55
Family Proteasome subunits 0.000000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012399   Gene: ENSOGAG00000013846   Transcript: ENSOGAT00000013847
Sequence length 219
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:3753821:3759078:1 gene:ENSOGAG00000013846 transcript:ENSOGAT00000013847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAGAPTGDLPWAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHQR
IYCALSGSAADAQAVADMAAYQLELHGLELEEAPLVLAAATVVRNITYKYREDLSAHLMV
AGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTYIYGYVDAAYKPGMSPEECRRFTTDAIA
LAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDD
Download sequence
Identical sequences H0X9X9
XP_003789117.1.62490 ENSOGAP00000012399 ENSOGAP00000012399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]