SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012715 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012715
Domain Number 1 Region: 809-999
Classification Level Classification E-value
Superfamily Nucleotide cyclase 5.65e-64
Family Adenylyl and guanylyl cyclase catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 93-427
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.02e-49
Family L-arabinose binding protein-like 0.0011
Further Details:      
 
Domain Number 3 Region: 505-774
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-45
Family Protein kinases, catalytic subunit 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012715   Gene: ENSOGAG00000014186   Transcript: ENSOGAT00000014193
Sequence length 1072
Comment pep:known_by_projection scaffold:OtoGar3:GL873643.1:3320672:3402705:-1 gene:ENSOGAG00000014186 transcript:ENSOGAT00000014193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLLLGLALWLLLFQPGLTFLFHQSCYHDNYEISVLMMNNSAFPEPHDNLKDAVSEGLE
IVRKRLQDAVYMAALVTISDGFVWREGNRERSDCDSNSCQRMDMGREILKEETVGCALIG
PSCTYSTFQMYLDMELSYPMISAGSFGLSCDYKETLTRLMTPARKLMYFLVNFWRINDMP
FKTFSWNSSYVYKDGTESEDCFWYLNALEAGVSYFSQELSFKETLRNKDQFQAILTDRNR
KSNVIVTCGTPTNISTLKGNHTAAEDIIIILVDLFNNYYFKENTTAPDFMENVLVLTLPP
ENFTANYSLFKNFSTVRNHFGLAYLNGILLFGHMLKIFLENKEDIPTRKFAYAFRNITFE
GYGGPVTLDDCGDVDNTMVLLYTSVETKKYIPLLKFDTHVNKTFPMDSNPTFIWKNHKLP
NDVPGQGPQVLLIAVFTLAGVLILLLLIALLVLRKYKRDNELRQKKWSHIPPENIFPLET
NETNHISLKIDDDKRRDTIQRLRQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQIDY
YNLTKFYGTVKLDTMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKGM
SYLHSSKTEVHGRLKSTNCVVDNRMVVKITDFGCNSILPPKKDLWTAPEHLRQANISQKG
DVYSYGIIAQEIILRKETFYTLSCRDRNEKIFRVENSNGTKPFRPDLFLETAEEKELEVY
LLVKNCWEEDPEKRPDFKKIENTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEE
RTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYST
PMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEIL
SFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLR
IHVSGSTIAILKRTEHQFLYEVRGETYLKGRGNEITYWLTGMKDQKYNLPTPPTVENQQR
LQAEFSDMIANSLKKREATGIRNQKPRRVASYKKGTLEYLQLGTTGQDNTYF
Download sequence
Identical sequences H0XAQ1
ENSOGAP00000012715 ENSOGAP00000012715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]