SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013003 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013003
Domain Number 1 Region: 29-586
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.05e-136
Family Gamma-glutamyltranspeptidase-like 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013003   Gene: ENSOGAG00000014508   Transcript: ENSOGAT00000014515
Sequence length 586
Comment pep:known_by_projection scaffold:OtoGar3:GL873800.1:899:33752:-1 gene:ENSOGAG00000014508 transcript:ENSOGAT00000014515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWGRGATVSLVLLGLGLVLAIVMPAVLLSRRQAPCSPPGFSHAAVAADSKICSDIGRAI
LQKQGSPVDAAIAALVCTGIVNPQSMGLGGGVIFTIYNATTGKVDIINARETVPANCTLD
LLDQCERAQPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTITLLRGGHHVPPVL
GMFLNNSFLRPLLQASALRQLFFNGTEPLRPQDPLPWPVLATTLETVATEGAETFYTGKL
GQMLVEDIAKEGSRLTLQDLATFQPEVVDALEVPLGDYTLYSPPPPAGGAILGFILNVLR
GFNFSAASVASPQGSVNMYHHLVETLKFAEGQRWRLWDPRSHPEIQSTSRDLLGEALAQH
VRQQIDGRGDHQLSHYSLAGPWGHRMGTAHVSVLAEDGSAVAATSTINTPFGAMVYSPRT
GILLNNELLDLCWRRPSGSGVTPRPGERGGVGGARGACWPRIPGERPPSSMAPSILINEA
QGSKLVIGGAGGELIISAMAQAIMNKLWLGFDLRAAIAAPILHVNSQGHVEYEANFSQEV
QRGLQERGQRKNQRLYFLNVVQAVSQEGACVYAVSDMRKRGEAAGY
Download sequence
Identical sequences H0XBD0
ENSOGAP00000013003 ENSOGAP00000013003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]