SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013297 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013297
Domain Number 1 Region: 182-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 5.75e-59
Family Dystroglycan, domain 2 0.000000417
Further Details:      
 
Domain Number 2 Region: 497-597
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 2.67e-16
Family Dystroglycan, N-terminal domain 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013297   Gene: ENSOGAG00000014849   Transcript: ENSOGAT00000014850
Sequence length 895
Comment pep:known_by_projection scaffold:OtoGar3:GL873698.1:1742069:1794213:1 gene:ENSOGAG00000014849 transcript:ENSOGAT00000014850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVALLLLLPLWGRTFVLLLSVAMAQSGWPSEPSEAIRDWENHLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDVIASNGEIIKVSAVGKEALPSWLYWDLESHMLEGL
PLDTDKGVHYISVSAARLGANGSHVPQTSSVFSIEVYPEDHSEPQSVRAASPDPGELLSS
ACVADEPVTVLTVILDADLTKMTPKQRVDLLHKMRRFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNNVPDIRGVEAPAREGAMSAHLGYPVVGWHIA
NKKPSLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPSIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPTQPTRVSEAGTTVSGQIRPTMTIPGYMEPTAVVTPP
TTTTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPIRI
RTTTSGIPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDKEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQ
GDKAPVRFKAKFVGDPAPVVSDIHRKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWT
NNTLPLEPCPKEQIIGLSRRIAEDDGKPRPAFSNALEPDFKATSIAVTGSGSCRHLQFIP
VAPAKRVPSEVPPTEAPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQNVPETT
PLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences H0XC26
XP_012667384.1.62490 ENSOGAP00000013297 ENSOGAP00000013297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]