SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013890 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013890
Domain Number 1 Region: 406-629
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-34
Family Calponin-homology domain, CH-domain 0.00034
Further Details:      
 
Domain Number 2 Region: 103-260,398-480
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.68e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.061
Further Details:      
 
Domain Number 3 Region: 740-770
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000542
Family LIM domain 0.001
Further Details:      
 
Domain Number 4 Region: 707-739
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000128
Family LIM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013890   Gene: ENSOGAG00000015509   Transcript: ENSOGAT00000015517
Sequence length 1085
Comment pep:known_by_projection scaffold:OtoGar3:GL873521.1:5846138:5855555:-1 gene:ENSOGAG00000015509 transcript:ENSOGAT00000015517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AATVSAWPLPSPEAQEASMASPTSTNPAHAHFESFLQAQLCQDVLSSFQGLCGALGLEPG
GGLPQYHKIKAQLNYWNAKSLWAKLDKRAGQPVYQQGKACTSTKCLVVGAGPCGLRAAVE
LALLGARVVLVEKRTKFSRHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQL
LLLKVALLLGVEIHWGVTFTGLQPPPRKGSGWCAQLQPNPPVQLANYEFDVLISAAGGKF
VPEGFKVREMRGKLAIGITANFVNRRTVEETQVPEISGVAKIYNQSFFQSLLKATGIDLE
NIVYYKDDTHYFVMTAKKQCLLRLGVLRQDWPETDRLLGSANVVPEALQRFARAAADFAT
HGKLGKLEFAHGSRGQPDVSAFDFTSMMRAESSARVQEKHGARLLLGLVGDCLVEPFWPL
GTGVARGFLAAFDAAWMVKRWAEGTGPLEVLAERESLYQLLSQTSPENMHRNVAQYGLDP
ATRYPNLNLQAVTPNQVRDLYDVLANEPVQMSDKTDAGKPAAASAGTQEELLRWCQEQTA
GYPGVHVTNLSSSWTNGLALCALVHRLRPSLLEPSELQGMGALEATAWALKVAEHELGIT
PVVSAQAVVAGSDPLGLIAYLSQFHSTFKSTLHSSGPVGQASPGTSSAVLFLGKLQRTLQ
RTRAKENGEDIAGKKPRLEVEAETPSTEESSVPEPGVPLTPPSQHQEPGARNLCALCGED
LYVLERLYADGHFFHRSCFRCHTCEATLWPGGYGRLPGDKHFYCLQHLPQLDHKEDGSDQ
GPESLELPTPGEISMPPSPPTPRASQERASPVPNPSQPTRRLIRLSSPERQRLSSLHLTP
DPELEPPPKPPRSCSALARQALEGSFLGWGMPVQGPQVLVAMEEEESSSSSEEEEEEEED
VPLDADTEQVLLTLAKTSGTMNKYPTWRRTLLRRAKEEEMKRFCKAQAIQRRLNEIEAAL
RELEAKGVKLEQAIRSQSSSPEQQKELSVEQLLQLVQKRNSLVAEEAELMITVQELNLEE
KQWQLDQELRSYMNREETLKTAADRQAEDQVLRKLVDVVNQRDALIRFQEERRLSELTLG
SGAQG
Download sequence
Identical sequences H0XDE7
ENSOGAP00000013890 ENSOGAP00000013890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]