SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014050 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014050
Domain Number 1 Region: 590-854
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.92e-90
Family Eukaryotic proteases 0.0000000373
Further Details:      
 
Domain Number 2 Region: 339-446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-30
Family Spermadhesin, CUB domain 0.00089
Further Details:      
 
Domain Number 3 Region: 214-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-20
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 87-175
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000122
Family SEA domain 0.009
Further Details:      
 
Domain Number 5 Region: 523-559
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 453-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 490-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 8 Region: 564-602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000589
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014050   Gene: ENSOGAG00000015678   Transcript: ENSOGAT00000015686
Sequence length 855
Comment pep:known_by_projection scaffold:OtoGar3:GL873616.1:3671470:3707153:1 gene:ENSOGAG00000015678 transcript:ENSOGAT00000015686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSDRARKGSGGRKDLGAGLKYSSRLENMNGLEEGLEFLPVNNAEKVEKRGPRHWVVLMV
VLTVILLVSLLVGFLVWHFHYRNMRVQKVFNGYLRITNENFLEAYENSSSPEFISLANKV
KEALKLLYSKIPALGPYYKESAVTAFSEGSIISYYWSEFSIPPHLVDDAERAMAQERMVT
LPPRARARHSFQLTSVVAFPTDPRTLQRTQDNSCSFALHTRSGELTRFATPGFPDSPYPA
RARCQWALRGDADSVLSLTFRSFDVAPCDERGSDLVTVYNTLNPMDPHTLVQLCGTYPPS
YNLTFLSSQNVLLVTLITNTERRHPGFEATFFQLPKMSSCGGYLRDTQGTFSSPFYPGHY
PPNMDCTWDIEVPNNQNVKLRFKVFYLLEPDVPLGTCPKDYVEINGEKYCGEKPQFVVTS
KSNKITVRFHSDQSYTDTGFLAEYLSYDSSDPCPGQFMCNTGRCIKKELRCDGWADCTDF
SDELHCQCNASHQFTCKNKFCKPLFWLCDGMNDCGDNSDELMCTCPDQNFKCSNGKCVPK
SQQCDGKDDCGDGSDEATCDSGRVVTCTKHTYRCHNGLCLSKGNPECDGTKDCSDGSDEK
DCDCGLRSFTKQARVVGGVDAEVGEWPWQVSLHAQGQGHVCGASLISPSWLVSAAHCFID
DKGFRYSDPKQWTAFLGLHDQSERDVSGVQERSLKRIIRHPSFNDFTFDYDLALLELEQP
AEYSAVVRAICLPDASHDFPAGKAIWVTGWGHTQQGGSAALILQKGEIRVINQTTCEKLL
PQQITPRMMCVGFLSGGVDACQGDSGGPLSSVEDGGRIFQAGVVSWGEGCAQRNKPGVYT
KLSMFRDWIKEQTGV
Download sequence
Identical sequences H0XDT6
XP_003795957.2.62490 ENSOGAP00000014050 ENSOGAP00000014050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]