SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014371 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014371
Domain Number 1 Region: 412-675
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-53
Family YWTD domain 0.000000000229
Further Details:      
 
Domain Number 2 Region: 296-408,682-727
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000408
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 112-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000089
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 4 Region: 38-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.00018
Further Details:      
 
Domain Number 5 Region: 154-194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000107
Family LDL receptor-like module 0.00023
Further Details:      
 
Domain Number 6 Region: 209-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00022
Further Details:      
 
Domain Number 7 Region: 78-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 8 Region: 248-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014371   Gene: ENSOGAG00000016055   Transcript: ENSOGAT00000016057
Sequence length 869
Comment pep:known_by_projection scaffold:OtoGar3:GL873646.1:2930959:2975841:-1 gene:ENSOGAG00000016055 transcript:ENSOGAT00000016057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQIGTLRAEAAGMGLGGWRLRWIVALLLVAAGTAVEDRCERNEFQCQDGKCISYKWVCDG
SPECPDGSDEFPQTCMSVTCKSVDFSCGGRVNRCIPQFWRCDGQVDCENGLDEQGCPAKT
CSQDEFRCHDGKCISQQFVCDSERDCLDGSDEASCPVTTCSPANFQCNDSTCIPDLWACD
GDPDCKDGSDEWPDRCGGRETLATQGNNGPCSSHEFHCHSGECIHSSWHCDGGPDCKDES
DEENCAVSTCRPDEFQCLDGTCVHGSRQCDWEYDCKDMSDEHGCINVTRCEGPNKFKCHS
GECITLDKVCNSVRDCRDWSDEPIKECGTNECLDNNGGCSHICNDLKIGYKCLCPDGFQL
VDQRRCEDIDECQDPDTCSQICVNLEGSYKCECEDGFQLDPHTKACKAVGSIAYLFFTNR
HEVRKMTLDRSEYTSLIPNLKNVVALDTEVASNRIYWSDLSQRKIYSTQIDGAHGFSSYD
TVISGDLQAPDGLAVDWVHGNIYWTDSVLGTVSVADTKGMKRKTLFKEKGSKPRAIVVDP
VHGFMYWTDWGTPAKIKKGGLNGVDVYSLVTEGIQWPNGITLDLSSGRLYWVDSKLHSIS
SIDVNGGNRKTVLEDKKRLAHPFSLAIFEDKVFWTDIINEAIFSANRLTGSDINLVAENL
LSPEDIVLFHNFTQPKALGVNWCERPTLRNGGCQYLCLPAPQINPHSPKFTCACPDGMLL
AKDMRSCLTEAESLVTTQGTSTSRPLVTSKTVAPKHTVTWPAPDTSRLTTAEIVTMSFQA
LGDIAGRENKEKPGSVGALSIVLPIAILVLLCFGAFLVWKNWRLKSINSINFDNPVYQKT
TEDEVHICRSQDGYAYPSRQMVSLEDDVA
Download sequence
Identical sequences H0XEJ3
ENSOGAP00000014371 ENSOGAP00000014371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]