SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014402 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014402
Domain Number 1 Region: 492-793
Classification Level Classification E-value
Superfamily L domain-like 2.55e-45
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 42-433
Classification Level Classification E-value
Superfamily L domain-like 3.4e-37
Family Ngr ectodomain-like 0.0018
Further Details:      
 
Domain Number 3 Region: 881-1037
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.01e-34
Family Toll/Interleukin receptor TIR domain 0.0000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014402   Gene: ENSOGAG00000016092   Transcript: ENSOGAT00000016094
Sequence length 1048
Comment pep:known_by_projection scaffold:OtoGar3:GL873584.1:9981391:9984537:1 gene:ENSOGAG00000016092 transcript:ENSOGAT00000016094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAFSMWTLKRQFLILFNIIIISKFLGARWFPKTLPCTVHVDTPHVIVDCTDKHLMEIPGG
IPANTTNITLTINHIPNISPASFHRLDHLVEIDFRCNCIPIRLGSKNNICTRRLEIKPRS
FSGLTSLKSLYLDGNQLLEIPEDLPPSLRLLSLEANSIFSIMRDNLTGLANIEILYLGQN
CYYRNPCNVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNLITNIQK
DDFSNLKQLQILDLSGNCPRCYNVPFPCTPCENNSALEIHLNAFDALTELRVLRLHSNSL
QLVPRRWFKNIKKLQELDLSQNFLAREIGDAQFLHFLPNLIQLDLSFNYELQVYRAFMNL
SDTFSSLKNLRVLRIKGYVFKELKSLNLSPLQNLPNLEVLDLGTNFIKIANLSIFKQFAR
LKVIDLSMNKISPSGDSSEVCFSSNTRTSVDSPRFRVFESLHYFRYDEYARSCRFKNKET
PSIMPFDDECHQYGPTLDLSRNNIFFVKASDFDNLLFLRCLNLSGNTIGQTLNGSEFKPL
KDLKYLDFSNNRLDLLYSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKFLKKL
MMNDNDISTSTSRTMESESLITLEFRGNHLDILWRDGDNRYLKFFMNLVKLEKLDISKNS
LSFLPPGVFDSMPPNLKNLSLAHNELKSFNWGNLHFLRALETLDLSHNHLTTVPERLSNC
SRSLKKLILKHNQIRDLTKHFLQDAFELRHLDLSSNKIQVIQKSSFPENVLNNLEMLLLH
HNPFLCTCDAVWFVWWVNHTEVTIPYLATEVTCVGPGAHKGQSVVSLDLYTCELDLTNLI
LFSFSLSAALFLMVVTTASHLYFWDVWYSYHFCKAKIKGYQRLIPPDSCYDAFIVYDTKD
PAVTDWVLDELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKY
AKTEKFKIAFYLSHQRLMDEKVDVIILIFLEKPLQKSKFLQLRKRLCGSSVLEWPTNPQA
HPYFWQCLKNALATDNHVVYSQVFKETA
Download sequence
Identical sequences H0XEM3
ENSOGAP00000014402 ENSOGAP00000014402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]