SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000014550 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000014550
Domain Number 1 Region: 28-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 69-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 109-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000014550   Gene: ENSOGAG00000016253   Transcript: ENSOGAT00000016258
Sequence length 345
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:62664017:62855312:1 gene:ENSOGAG00000016253 transcript:ENSOGAT00000016258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLAPHLCLILSSAPQSQLLPGNNFTNECNIPGNFMCGNGRCIPGAWQCDGLPDCFDKSDE
KECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHCK
NGLCIDKSFICDGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSSV
IFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQY
VASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSAD
SASSQAASSLLSVEDTGRSPGQPGPPEEGTAEPRDSVPSQGTEEV
Download sequence
Identical sequences H0XEZ2
ENSOGAP00000014550 ENSOGAP00000014550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]