SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015301 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015301
Domain Number 1 Region: 399-743
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 8.5e-125
Family Oxysterol-binding protein 0.0000371
Further Details:      
 
Domain Number 2 Region: 27-114,145-265
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-24
Family Pleckstrin-homology domain (PH domain) 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015301   Gene: ENSOGAG00000017084   Transcript: ENSOGAT00000017091
Sequence length 891
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:41103512:41262676:1 gene:ENSOGAG00000017084 transcript:ENSOGAT00000017091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGLADGEPDRTSLLGDSKDVLGPSNVIANSEEAQLLTPGKMSQRQGREAYPTPTKDLH
QPSLSPASPHSQGFERGKEDISQNKDESSLSMSKSKSESKLYNGSEKDSSTSNKLTKKES
LKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYK
TQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPS
SYLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSISSDSTHVTLYGLLRA
NNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEVLGKSEESDTDTSER
QDDSYIEPEPVEPLKETTYTEESHEELGEAGEASQTETVSEENKSLIWTLLKQVRPGMDL
SRVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRLKKVVKWYLSGFYKKPKGL
KKPYNPILGETFRCLWIHPRTNSKTFYIAEQVSHHPPISAFYVSNRKDGFCLSGSILAKS
KFYGNSLSAILEGEARLTFLNRGEDYVMTMPYAHCKGILYGTMTLELGGTVNITCQKTGY
SAILEFKLKPFLGSSDCVNQISGKLKLGKEVLATLEGHWDSEVFINDKKTDNSEVFWNPT
PDIKQWRLIRHTVKFEEQGDFESEKLWQRVTRAINAKDQTEATQEKYVLEEAQRQAARDR
KTKNEEWTCKLFELDPLTGEWHYKFAENMQNVPINRSPQNDRDWVYRDREEARNCFLVSV
PKMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSLKPSTRRKKGIELGDIQSSIESIKQ
TQEEIKSRNIMALRNHLVSSTPATDYFLQQKDYFIIFLLILLQVVINFMFK
Download sequence
Identical sequences H0XGT4
ENSOGAP00000015301 ENSOGAP00000015301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]