SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015319 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015319
Domain Number 1 Region: 31-378
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.09e-78
Family (Glycosyl)asparaginase 0.0000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015319   Gene: ENSOGAG00000017103   Transcript: ENSOGAT00000017109
Sequence length 407
Comment pep:known_by_projection scaffold:OtoGar3:GL873544.1:2118441:2405803:1 gene:ENSOGAG00000017103 transcript:ENSOGAT00000017109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMEKGMSSGEGLPSRSSQEKQSHKEKRGGFVLVHAGAGYHSESKAKEYKHVCKRACQKA
IEKLQAGALATDAVTAALVELEDSPFTNAGMGSNLNLLGEIECDASIMDGKSLNFGAVGA
LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAHRWAVDHGIPSCPPNIMTTRFS
LAAFKRNKRKLELAERVETDFIQLKKRRQSSEKENDSGTLDTVGAVVVDHEGNVAAAVSS
GGLALKHPGRVGQAALYGCGCWAENTGAHNPYSTAVSTSGCGEHLVRTILARECSHALQA
EDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCRCSEADSSQNKQTLLVEFLWSHT
TESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN
Download sequence
Identical sequences H0XGV1
ENSOGAP00000015319 ENSOGAP00000015319 XP_003788055.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]