SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015615 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015615
Domain Number 1 Region: 212-325
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-20
Family Voltage-gated potassium channels 0.0044
Further Details:      
 
Domain Number 2 Region: 32-65,108-177
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.58e-19
Family Voltage-gated potassium channels 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015615   Gene: ENSOGAG00000032494   Transcript: ENSOGAT00000031369
Sequence length 430
Comment pep:known_by_projection scaffold:OtoGar3:GL873543.1:5810211:5860550:-1 gene:ENSOGAG00000032494 transcript:ENSOGAT00000031369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRSPRPPPRRCRRRLPRPSCCCCCCRRSHLNEDTGRFVLLAALIGLYLVAGATVFSAL
ESPGEAEARARWGATLRNFSAAHGVAEPELRAFLRHYEAALAAGVRADALRPRWDFPGAF
YFVGTVVSTIGFGMTTPATVGGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACR
ERQLRRSGLLPATFRRGSALSDADSLAGWKPSVYHVLLILGLFAVLLSCCASAMYTSVEG
WDYMDSLYFCFVTFSTIGFGDLVSSQHAAYRNQGLYRLGNFLFILLGVCCIYSLFNVISI
LIKQVLNWMLRKLSCRCCARCCPAPGAPLARRNAITPGSRLRRRLAALGADPAARDSDAE
GRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGALGIMN
NRLAETSASR
Download sequence
Identical sequences H0XHM5
ENSOGAP00000015615 XP_003787946.1.62490 ENSOGAP00000015615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]