SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000015929 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000015929
Domain Number 1 Region: 324-402
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.53e-25
Family Intermediate filament protein, coiled coil region 0.0000415
Further Details:      
 
Domain Number 2 Region: 92-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000134
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 98-206
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000523
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000015929   Gene: ENSOGAG00000029454   Transcript: ENSOGAT00000031778
Sequence length 499
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:17303021:17316375:-1 gene:ENSOGAG00000029454 transcript:ENSOGAT00000031778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGSGSFRSQSLSRCNVASSAACSSASSL
GLGLAYRRSPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNR
ALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARAQALLERDGLAEEVQRLRA
RCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLA
TLQASSQAAAEVDVAVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR
STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQ
LENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGVNPL
PNPSYLLPPRILSSTTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVIS
TKKTEKSNIEESTISSQKM
Download sequence
Identical sequences H0XII9
XP_003787253.1.62490 ENSOGAP00000015929 ENSOGAP00000015929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]