SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000016594 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000016594
Domain Number 1 Region: 34-569
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.67e-166
Family Gamma-glutamyltranspeptidase-like 0.000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000016594   Gene: ENSOGAG00000024414   Transcript: ENSOGAT00000025606
Sequence length 569
Comment pep:novel scaffold:OtoGar3:GL873800.1:36632:49256:-1 gene:ENSOGAG00000024414 transcript:ENSOGAT00000025606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRYLLLGLLAVVLVVAIVSLCLWLPSTSREPSHHVYPKAAVAADAKCCSEIGRDVLLD
GGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPGLAFASMFN
SSKQSQDGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKALAAALKN
KQAAIEGQPALCEVFCRDGKVLQEGEMLTLPRLADTYETLAREGAQAFYNGSLTAQIVKD
IQEAGGIVTVEDLNNYRAKLIEHPLNITLGDMVLYTPSAPLSGPVLSLILNILKGYNFSP
ESVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDMTKVVLNMTSEFFAAQLRARISD
DTTHPASYYEPEYYTPNDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSRLSGILFNDE
MDDFSSPNIINQFGVPPSPANFIKPGKQPLSSMCPTIIVDQDGRVRMVVGASGGTHITTA
TALAIIHHLWFGYNVKQAVEEPRLHNQLLPNVTTLEKDLDEVVVAALKTRHHQTQLASPF
IAVVQAIAHTARGWAAASDSRKGGEPAGY
Download sequence
Identical sequences H0XKF4
ENSOGAP00000016594 ENSOGAP00000016594 XP_003803181.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]