SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017072 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017072
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.34e-36
Family SCAN domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.93e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 740-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 797-853
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 909-965
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 516-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 628-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 853-909
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 461-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 208-265
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 11 Region: 572-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.32e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 685-741
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 13 Region: 364-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.63e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 950-998
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000439
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017072   Gene: ENSOGAG00000028821   Transcript: ENSOGAT00000028952
Sequence length 1027
Comment pep:known_by_projection scaffold:OtoGar3:GL873601.1:5957426:5974248:1 gene:ENSOGAG00000028821 transcript:ENSOGAT00000028952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRENWAHSALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQLHRPGSGEEAVALVEEL
QKDLDGPALKVPVFVKDQEILQEMSTLGTIPPIPTGSHIAAEICPSLTEQMVFNLQDPQH
DSPAHEAANLSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRALYW
DVMLENYGNVTSLEWESMIENEEVTSKPSISQRADSQKGTSKRLQGGVPQVPDFEEECEW
QVLSSQWENEMGGKTDTVKKSSLCEQDRKKRTAPPEKQGQMWKEFGESVTLDSAISESLV
GTEGKKFYRCDICCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNHSG
EKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGERPY
KCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKCDE
CGKTFAQTTYLVDHQRLHSTENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCGKI
FSSKSNLIDHKRMHSREKPYKCSECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFILK
KSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIMSKSFM
VHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRAFSSNRNLIEHKR
IHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIHTG
EKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTGEKPY
KCDECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGCND
CSKVFRQRKNLTVHQKIHTDEKPCECEESEKEYSQTSKIHVPQKIHTVEEFSWLQNANES
KVDIQKI
Download sequence
Identical sequences H0XLT2
ENSOGAP00000017072 XP_012663523.1.62490 ENSOGAP00000017072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]