SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000017547 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000017547
Domain Number 1 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 511-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 5 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 553-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-22
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 9 Region: 133-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.1e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 4-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.19e-17
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 11 Region: 103-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000318
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000017547   Gene: ENSOGAG00000025289   Transcript: ENSOGAT00000027917
Sequence length 610
Comment pep:novel scaffold:OtoGar3:GL873610.1:7635330:7671562:-1 gene:ENSOGAG00000025289 transcript:ENSOGAT00000027917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGSELFRDVAILFSQEEWQWLVPAQRDLYRDVMLETYSNLVSLVLESGCDAKVLSPKQ
HIYEVESPQWEIVESLTGYSLECSSFQDDWECRSQFIKEHRNQESLDFYQKIHTGEKPYG
YDKCRKDFWQKIHTNEKPYKCKECGKAFKYGSRLIQHENIHSGKKPYECKECGKAFNSGS
NFIQHQRVHTGEKPYECKDCAKAFSRSSQLIEHQRIHTGEKPYQCKECGKAFNRISHLKV
HYRIHTGEKPYACKECGKTFSHRSQLIQHQTVHTGKKLYECKECGKAFNQGSTLIRHQRI
HTGEKPYECQVCGKAFRVNSQLKQHQRIHTGEKPYQCKECGKAFSHCSQLIQHQRIHTGE
KPYECKECGKAFKQRQHLAQHHRTHTGEKLFECKECRKAFKQSEHLIQHQRIHTGEKPYK
CKECRKAFRQPAHLAQHQRIHTGEKPYECKECGKAFSHHGSLTQHQRVHSGEKPYECKEC
GKAFRQNIHLASHLRIHTGEKPYECKECGKAFRISSQLATHQRIHTGEKPYDCQECGKAF
KQKSHLAQHQKTHTGEKPYQCSECGKAFSQTSNLIQHQRVHTGEKPYKCTECGKAFSDSS
SRTQHQRLHS
Download sequence
Identical sequences H0XN56
ENSOGAP00000017547 ENSOGAP00000017547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]