SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018563 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018563
Domain Number 1 Region: 239-356
Classification Level Classification E-value
Superfamily Caspase-like 7.33e-28
Family Caspase catalytic domain 0.0000376
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000018563
Domain Number - Region: 8-75
Classification Level Classification E-value
Superfamily DEATH domain 0.00353
Family Caspase recruitment domain, CARD 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018563   Gene: ENSOGAG00000025866   Transcript: ENSOGAT00000024223
Sequence length 357
Comment pep:novel scaffold:OtoGar3:GL873719.1:969196:980537:1 gene:ENSOGAG00000025866 transcript:ENSOGAT00000024223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTENNQENKNPLKMLEALGKDVINEFLNTLSDKNVVKIKEEEKENFRTARTKDKARIFGA
SLKEKQEEAVRLLMETCLFLEEKPTSKEAPPNTKTGPPEAAEPTDTLKLCPHEDFLRLSK
ERAGEVLCSMHETGKKRKTIAFGNKILGVKIVVIFYIGASSKEENMGFMHILILCKYNDK
MQPTLFLHLCIQIIDLGLMTISSVTVESKLKGLDRKHIFKIYCRRVARSAGKFPHNLIRG
KNRGEVWVRDSPEALVDSTSQSPDTLEDDAVHKTHVEKDFIAFCSSTPHNVSWRDRTKGS
LFITQLVTCFQKYSWHYHLEEIFRKVQQSFETPSVRAQMPTVERLSMTRYFYLFPGN
Download sequence
Identical sequences H0XR21
ENSOGAP00000018563 ENSOGAP00000018563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]