SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000018776 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000018776
Domain Number 1 Region: 319-682
Classification Level Classification E-value
Superfamily SIS domain 3.99e-103
Family double-SIS domain 0.000000393
Further Details:      
 
Domain Number 2 Region: 3-212,250-294
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.48e-51
Family Class II glutamine amidotransferases 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000018776   Gene: ENSOGAG00000008940   Transcript: ENSOGAT00000026703
Sequence length 682
Comment pep:known_by_projection scaffold:OtoGar3:GL873587.1:6444717:6490497:1 gene:ENSOGAG00000008940 transcript:ENSOGAT00000026703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAGIFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGVDGGNDKDWEANACKIQLI
KKKGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPNPVNSHPQRSDKNNEFIV
IHNGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNRDSQDISFTTLVERVIQQ
LEGAFALVFKSVHFPGQAVGTRRGSPLLIGVRSEHKLSTDHIPILYRTVCKDKKGSCNLS
RVDSTTCLFPVEEKAVEYYFASDASAVIEHTNRVIFLEDDDVAAVVDGRLSIHRIKRTAG
DHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDH
IKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
LSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKS
VLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTY
AKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFH
LAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences H0XRN4
ENSOGAP00000018776 ENSOGAP00000018776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]