SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000019276 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000019276
Domain Number 1 Region: 23-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 252-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 326-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.11e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 217-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000018
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000019276   Gene: ENSOGAG00000032142   Transcript: ENSOGAT00000033119
Sequence length 382
Comment pep:novel scaffold:OtoGar3:GL873520.1:46062203:46063381:1 gene:ENSOGAG00000032142 transcript:ENSOGAT00000033119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAFCKDSVLQNGSVQEEKQEADSLQEPVTFKDVIVEFSEEEWGHLDSAVKKMYRDVMLEN
YKNLNSLHKAHLLAKPAEIPKLENKIKRWIMEEEIPRTAVFDMKTIPEKEESSHEVITTR
LIESEHLPLDVWKSEDWLYRNQKKQDINLSPEAFINTTTYTEEGDFECSENKKSFDVNSV
NSIYDIQQGIPIRKGSPKCDKFETNLGFNSVDKPHSEYDECGNALNLSTDIIRHQKSHTT
MNSYECYQCGKAFSRRSSLTRHQIIHTGEKPYKCSECGKFFNRCTNLIKHQKIHTKEKSL
KDSKCEIALRQSEDNGKKRLHSGDNFYECVDCGKSFNRSSSLIRHQMIHTGDKPFKCKEC
KLSFNRNSNLCRHQRRHTQKVL
Download sequence
Identical sequences H0XT34
ENSOGAP00000019276 ENSOGAP00000019276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]