SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000021181 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000021181
Domain Number 1 Region: 5-233
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.09e-79
Family Proteasome subunits 0.000000000813
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000021181   Gene: ENSOGAG00000025507   Transcript: ENSOGAT00000026151
Sequence length 234
Comment pep:novel scaffold:OtoGar3:GL873573.1:8226412:8227251:1 gene:ENSOGAG00000025507 transcript:ENSOGAT00000026151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
Download sequence
Identical sequences H0XYI8
ENSOGAP00000021181 ENSOGAP00000021181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]